Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLMGC9T)

DOT Name	Sperm protein associated with the nucleus on the X chromosome B1 (SPANXB1)
Synonyms	Cancer/testis antigen 11.2; CT11.2; Nuclear-associated protein SPAN-Xb; SPANX-B; SPANX family member B1; SPANX family member F1
Gene Name	SPANXB1
Related Disease	leukaemia ( ) Leukemia ( ) Prostate cancer ( ) Prostate carcinoma ( ) Melanoma ( ) Metastatic malignant neoplasm ( ) Testicular cancer ( ) Triple negative breast cancer ( )
UniProt ID	SPNXB_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07458
Sequence	MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVR YRRNVKRTSPEELLNDHARENRINPDQMEEEEFIEITTERPKK
Tissue Specificity	Detected in testis and sperm.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
leukaemia	DISS7D1V	Strong	Genetic Variation	[1]
Leukemia	DISNAKFL	Strong	Genetic Variation	[1]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[2]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[2]
Melanoma	DIS1RRCY	moderate	Biomarker	[3]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[4]
Testicular cancer	DIS6HNYO	moderate	Biomarker	[4]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Sperm protein associated with the nucleus on the X chromosome B1 (SPANXB1).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Sperm protein associated with the nucleus on the X chromosome B1 (SPANXB1).	[6]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Sperm protein associated with the nucleus on the X chromosome B1 (SPANXB1).	[7]
------------------------------------------------------------------------------------

References

1	Combined high-resolution array-based comparative genomic hybridization and expression profiling of ETV6/RUNX1-positive acute lymphoblastic leukemias reveal a high incidence of cryptic Xq duplications and identify several putative target genes within the commonly gained region.Leukemia. 2007 Oct;21(10):2137-44. doi: 10.1038/sj.leu.2404879. Epub 2007 Aug 9.
2	Mutational analysis of SPANX genes in families with X-linked prostate cancer.Prostate. 2007 Jun 1;67(8):820-8. doi: 10.1002/pros.20561.
3	SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Sicilian patients with melanoma.Melanoma Res. 2008 Aug;18(4):295-9. doi: 10.1097/CMR.0b013e32830aaa90.
4	Cancer Testis Antigen Promotes Triple Negative Breast Cancer Metastasis and is Traceable in the Circulating Extracellular Vesicles.Sci Rep. 2019 Aug 12;9(1):11632. doi: 10.1038/s41598-019-48064-w.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
7	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.