Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLYAJIB)

• DOT Name: Rieske domain-containing protein (RFESD)
• Gene Name: RFESD
• Related Disease:
  Bipolar disorder
  Major depressive disorder
  Schizophrenia
• UniProt ID: RFESD_HUMAN
• Pfam ID: PF00355
• Sequence:
  MNLDGSAQDPEKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHS
  GGPLHLGDIEDFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGIKQRIH
  TVTVDNGNIYVTLSNEPFKCDSDFYATGDFKVIKSSS

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[1]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[1]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[1]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Rieske domain-containing protein (RFESD).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Rieske domain-containing protein (RFESD).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Rieske domain-containing protein (RFESD).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Rieske domain-containing protein (RFESD).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Rieske domain-containing protein (RFESD).	[6]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Rieske domain-containing protein (RFESD).	[7]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Rieske domain-containing protein (RFESD).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Rieske domain-containing protein (RFESD).	[8]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Rieske domain-containing protein (RFESD).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Rieske domain-containing protein (RFESD).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Rieske domain-containing protein (RFESD).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Rieske domain-containing protein (RFESD).	[9]

References

• [1] Genome-wide association study identifies common variants associated with pharmacokinetics of psychotropic drugs.J Psychopharmacol. 2015 Aug;29(8):884-91. doi: 10.1177/0269881115584469. Epub 2015 May 5.
• [2] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.