Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNUI7O1)

DOT Name Transmembrane protein 132A (TMEM132A)
Synonyms HSPA5-binding protein 1
Gene Name TMEM132A
Related Disease
Acute undifferentiated leukemia ( )
Hepatitis C virus infection ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
Polyp ( )
Advanced cancer ( )
Hypoglycemia ( )
Coronary heart disease ( )
UniProt ID
T132A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16070 ; PF15706 ; PF15705
Sequence
MCARMAGRTTAAPRGPYGPWLCLLVALALDVVRVDCGQAPLDPVYLPAALELLDAPEHFR
VQQVGHYPPANSSLSSRSETFLLLQPWPRAQPLLRASYPPFATQQVVPPRVTEPHQRPVP
WDVRAVSVEAAVTPAEPYARVLFHLKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPS
LGACVVELELPSHWFSQASTTRAELAYTLEPAAEGPGGCGSGEENDPGEQALPVGGVELR
PADPPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHNFTASLLTLRIKVKKGLHVTA
ARPAQPTLWTAKLDRFKGSRHHTTLITCHRAGLTEPDSSPLELSEFLWVDFVVENSTGGG
VAVTRPVTWQLEYPGQAPEAEKDKMVWEILVSERDIRALIPLAKAEELVNTAPLTGVPQH
VPVRLVTVDGGGALVEVTEHVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWR
RLRASLRLTVWAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASDEAERRARGCH
LQYQRAGVRFLAPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAPHARVLDSRVASLEGGRV
VVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVLELRVQPVMGISLTLSRGTAHPGE
VTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQ
GAQLGVVVSGAGAEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPASTPAPALPSSP
AWSPPATEATMGGKRQVAGSVGGNTGVRGKFERAEEEARKEETEAREEEEEEEEEMVPAP
QHVTELELGMYALLGVFCVAIFIFLVNGVVFVLRYQRKEPPDSATDPTSPQPHNWVWLGT
DQEELSRQLDRQSPGPPKGEGSCPCESGGGGEAPTLAPGPPGGTTSSSSTLARKEAGGRR
KRVEFVTFAPAPPAQSPEEPVGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIR
GSS
Function
May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation.
Reactome Pathway
Post-translational protein phosphorylation (R-HSA-8957275 )
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute undifferentiated leukemia DISJ4SSG Strong Altered Expression [1]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [2]
Neoplasm DISZKGEW Strong Biomarker [3]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [4]
Polyp DISRSLYF Strong Genetic Variation [5]
Advanced cancer DISAT1Z9 moderate Genetic Variation [6]
Hypoglycemia DISRCKR7 moderate Biomarker [7]
Coronary heart disease DIS5OIP1 Limited Altered Expression [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Transmembrane protein 132A (TMEM132A). [9]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Transmembrane protein 132A (TMEM132A). [10]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Transmembrane protein 132A (TMEM132A). [11]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Transmembrane protein 132A (TMEM132A). [12]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Transmembrane protein 132A (TMEM132A). [13]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Transmembrane protein 132A (TMEM132A). [14]
------------------------------------------------------------------------------------

References

1 Loss of TRIM62 expression is an independent adverse prognostic factor in acute myeloid leukemia.Clin Lymphoma Myeloma Leuk. 2015 Feb;15(2):115-127.e15. doi: 10.1016/j.clml.2014.07.011. Epub 2014 Aug 12.
2 Clinical detection of Hepatitis C viral infection by yeast-secreted HCV-core:Gold-binding-peptide.Biosens Bioelectron. 2018 Nov 15;119:230-236. doi: 10.1016/j.bios.2018.07.026. Epub 2018 Aug 22.
3 Glypican-3 (GPC3) targeted Fe(3)O(4) core/Au shell nanocomplex for fluorescence/MRI/photoacoustic imaging-guided tumor photothermal therapy.Biomater Sci. 2019 Dec 1;7(12):5258-5269. doi: 10.1039/c9bm01248f. Epub 2019 Oct 11.
4 DEVOTE 5: Evaluating the Short-Term Cost-Utility of Insulin Degludec Versus Insulin Glargine U100 in Basal-Bolus Regimens for Type 2 Diabetes in the UK.Diabetes Ther. 2018 Jun;9(3):1217-1232. doi: 10.1007/s13300-018-0430-4. Epub 2018 Apr 30.
5 Correlation of dyslipidemias and gallbladder polyps-A large retrospective study among Chinese population.Asian J Surg. 2020 Jan;43(1):181-185. doi: 10.1016/j.asjsur.2019.01.013. Epub 2019 Mar 15.
6 Involvement of androgen receptor and glucose-regulated protein 78 kDa in human hepatocarcinogenesis.Exp Cell Res. 2014 May 1;323(2):326-36. doi: 10.1016/j.yexcr.2014.02.017. Epub 2014 Feb 26.
7 A role for exogenous GLP-1 in the management of postprandial hypoglycaemia after Roux-en-Y gastric bypass?.Eur J Endocrinol. 2019 Sep;181(3):C5-C8. doi: 10.1530/EJE-19-0473.
8 Increased endoplasmic reticulum stress and Nrf2 repression in peripheral blood mononuclear cells of patients with stable coronary artery disease.Free Radic Biol Med. 2014 Mar;68:178-85. doi: 10.1016/j.freeradbiomed.2013.12.017. Epub 2013 Dec 27.
9 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
10 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
13 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.