Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNYK59J)

DOT Name Kallikrein-12 (KLK12)
Synonyms EC 3.4.21.-; Kallikrein-like protein 5; KLK-L5
Gene Name KLK12
Related Disease
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Colorectal carcinoma ( )
Gastric cancer ( )
Gastric neoplasm ( )
High blood pressure ( )
Lung cancer ( )
Lung carcinoma ( )
Polycythemia ( )
Stomach cancer ( )
Systemic sclerosis ( )
Tuberculosis ( )
Adenocarcinoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
KLK12_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.4.21.-
Pfam ID
PF00089
Sequence
MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTA
AHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRV
TSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRI
TSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDW
IRMIMRNN
Reactome Pathway
Formation of the cornified envelope (R-HSA-6809371 )

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Breast cancer DIS7DPX1 Strong Altered Expression [2]
Breast carcinoma DIS2UE88 Strong Altered Expression [2]
Breast neoplasm DISNGJLM Strong Genetic Variation [2]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [3]
Gastric cancer DISXGOUK Strong Altered Expression [4]
Gastric neoplasm DISOKN4Y Strong Genetic Variation [1]
High blood pressure DISY2OHH Strong Biomarker [5]
Lung cancer DISCM4YA Strong Biomarker [6]
Lung carcinoma DISTR26C Strong Biomarker [6]
Polycythemia DIS8B6VW Strong Biomarker [5]
Stomach cancer DISKIJSX Strong Altered Expression [4]
Systemic sclerosis DISF44L6 Strong Biomarker [7]
Tuberculosis DIS2YIMD Strong Biomarker [8]
Adenocarcinoma DIS3IHTY moderate Biomarker [9]
Prostate cancer DISF190Y Limited Altered Expression [3]
Prostate carcinoma DISMJPLE Limited Altered Expression [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Kallikrein-12 (KLK12) affects the response to substance of Cisplatin. [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Kallikrein-12 (KLK12). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Kallikrein-12 (KLK12). [11]
------------------------------------------------------------------------------------

References

1 Splice-site genetic polymorphism of the human kallikrein 12 (KLK12) gene correlates with no substantial expression of KLK12 protein having serine protease activity.Hum Mutat. 2004 Sep;24(3):273-4. doi: 10.1002/humu.9270.
2 Human kallikrein-related peptidase 12 (KLK12) splice variants discriminate benign from cancerous breast tumors.Clin Biochem. 2018 Aug;58:78-85. doi: 10.1016/j.clinbiochem.2018.05.017. Epub 2018 May 25.
3 Knockdown of KLK12 inhibits viability and inducesapoptosis in human colorectal cancer HT-29 cell line.Int J Mol Med. 2019 Nov;44(5):1667-1676. doi: 10.3892/ijmm.2019.4327. Epub 2019 Aug 30.
4 Clinical significance of human kallikrein 12 gene expression in gastric cancer.World J Gastroenterol. 2012 Dec 7;18(45):6597-604. doi: 10.3748/wjg.v18.i45.6597.
5 Transcriptome reveals the overexpression of a kallikrein gene cluster (KLK1/3/7/8/12) in the Tibetans with high altitude-associated polycythemia.Int J Mol Med. 2017 Feb;39(2):287-296. doi: 10.3892/ijmm.2016.2830. Epub 2016 Dec 14.
6 CASC15 contributes to proliferation and invasion through regulating miR-766-5p/ KLK12 axis in lung cancer.Cell Cycle. 2019 Sep;18(18):2323-2331. doi: 10.1080/15384101.2019.1646562. Epub 2019 Aug 5.
7 The antiangiogenic tissue kallikrein pattern of endothelial cells in systemic sclerosis.Arthritis Rheum. 2005 Nov;52(11):3618-28. doi: 10.1002/art.21383.
8 Kallikrein 12 Regulates Innate Resistance of Murine Macrophages against Mycobacterium bovis Infection by Modulating Autophagy and Apoptosis.Cells. 2019 May 5;8(5):415. doi: 10.3390/cells8050415.
9 Human kallikrein-related peptidase 12: antibody generation and immunohistochemical localization in prostatic tissues.Prostate. 2007 Sep 15;67(13):1465-74. doi: 10.1002/pros.20596.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
12 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.