Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOANEHZ)

DOT Name Cysteine/serine-rich nuclear protein 3 (CSRNP3)
Synonyms CSRNP-3; Protein FAM130A2; TGF-beta-induced apoptosis protein 2; TAIP-2
Gene Name CSRNP3
Related Disease
Attention deficit hyperactivity disorder ( )
Drug dependence ( )
Substance abuse ( )
Substance dependence ( )
Alcohol dependence ( )
Alcohol-induced disorders ( )
Alcohol-related disorders ( )
UniProt ID
CSRN3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16019
Sequence
MSGILKRKFEEVDGSSPCSSVRESDDEVSSSESADSGDSVNPSTSSHFTPSSILKREKRL
RTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREM
LREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTK
KRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRVFCDPDTCTCSLAGIKCQVDRMS
FPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHSEISAHSS
SMGPVAHSVEYSIADSFEIETEPQAAVLHLQSAEELDCQGEEEEEEEDGSSFCSGVTDSS
TQSLAPSESDEEEEEEEEEEEEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDGTAVHE
SHAKNASFYANSSTLYYQIDSHIPGTPNQISENYSERDTVKNGTLSLVPYTMTPEQFVDY
ARQAEEAYGASHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQ
EGFVSALNGDSHISEHPAENSLSLAEKSILHEECIKSPVVETVPV
Function Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. Plays a role in apoptosis.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Attention deficit hyperactivity disorder DISL8MX9 Strong Genetic Variation [1]
Drug dependence DIS9IXRC Strong Biomarker [2]
Substance abuse DIS327VW Strong Biomarker [2]
Substance dependence DISDRAAR Strong Biomarker [2]
Alcohol dependence DIS4ZSCO moderate Genetic Variation [3]
Alcohol-induced disorders DIS3SFYT moderate Genetic Variation [3]
Alcohol-related disorders DIS3K4KK moderate Genetic Variation [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [4]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [12]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [5]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [6]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [7]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [8]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [10]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [13]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Cysteine/serine-rich nuclear protein 3 (CSRNP3). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 A Genetic Investigation of Sex Bias in the Prevalence of Attention-Deficit/Hyperactivity Disorder.Biol Psychiatry. 2018 Jun 15;83(12):1044-1053. doi: 10.1016/j.biopsych.2017.11.026. Epub 2017 Dec 2.
2 Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
3 Ancestry-specific and sex-specific risk alleles identified in a genome-wide gene-by-alcohol dependence interaction study of risky sexual behaviors.Am J Med Genet B Neuropsychiatr Genet. 2017 Dec;174(8):846-853. doi: 10.1002/ajmg.b.32604. Epub 2017 Oct 9.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
7 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
8 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
10 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
11 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
14 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
15 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.