Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPG0K7E)

• DOT Name: Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2)
• Synonyms: IMP dehydrogenase 2; IMPD 2; IMPDH 2; EC 1.1.1.205; Inosine-5'-monophosphate dehydrogenase type II; IMP dehydrogenase II; IMPDH-II
• Gene Name: IMPDH2
• UniProt ID: IMDH2_HUMAN
• PDB ID: 1B3O; 1NF7; 1NFB; 6I0M; 6I0O; 6U8E; 6U8N; 6U8R; 6U8S; 6U9O; 6UA2; 6UA4; 6UA5; 6UAJ; 6UC2; 6UDO; 6UDP; 6UDQ; 8FOZ; 8FUZ; 8G8F; 8G9B
• EC Number: 1.1.1.205
• Pfam ID: PF00571 ; PF00478
• Sequence:
  MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
  LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
  LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
  KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
  KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
  GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
  VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
  DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
  AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
• Function: Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors.
• Tissue Specificity: IMPDH1 is the main species in normal leukocytes and IMPDH2 predominates over IMPDH1 in the tumor.
• KEGG Pathway:
  Purine metabolism (hsa00230)
  Drug metabolism - other enzymes (hsa00983)
  Metabolic pathways (hsa01100)
  Nucleotide metabolism (hsa01232)
• Reactome Pathway:
  Purine ribonucleoside monophosphate biosynthesis (R-HSA-73817)
  Potential therapeutics for SARS (R-HSA-9679191)
  Azathioprine ADME (R-HSA-9748787)
  Neutrophil degranulation (R-HSA-6798695)
• BioCyc Pathway: MetaCyc:HS11242-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[1]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[19]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen affects the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[8]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[9]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[10]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[11]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[12]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[13]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[14]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[15]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid affects the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[16]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[17]
Mercaptopurine	DMTM2IK	Approved	Mercaptopurine increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[14]
Thioguanine	DM7NKEV	Approved	Thioguanine increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[14]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[18]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[18]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[20]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[21]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[18]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Inosine-5'-monophosphate dehydrogenase 2 (IMPDH2).	[22]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Identification of potential biomarkers of hepatitis B-induced acute liver failure using hepatic cells derived from human skin precursors. Toxicol In Vitro. 2015 Sep;29(6):1231-9. doi: 10.1016/j.tiv.2014.10.012. Epub 2014 Oct 24.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Multifaceted preventive effects of single agent quercetin on a human prostate adenocarcinoma cell line (PC-3): implications for nutritional transcriptomics and multi-target therapy. Med Oncol. 2011 Dec;28(4):1395-404. doi: 10.1007/s12032-010-9603-3. Epub 2010 Jul 2.
• [8] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [9] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [10] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [11] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [12] Expression profiling of nucleotide metabolism-related genes in human breast cancer cells after treatment with 5-fluorouracil. Cancer Invest. 2009 Jun;27(5):561-7.
• [13] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [14] Petit E, Langouet S, Akhdar H, Nicolas-Nicolaz C, Guillouzo A, Morel F. Differential toxic effects of azathioprine, 6-mercaptopurine and 6-thioguanine on human hepatocytes. Toxicol In Vitro. 2008;22(3):632-642. [PMID: 18222062]
• [15] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [16] Gene expression profiling of early primary biliary cirrhosis: possible insights into the mechanism of action of ursodeoxycholic acid. Liver Int. 2008 Aug;28(7):997-1010. doi: 10.1111/j.1478-3231.2008.01744.x. Epub 2008 Apr 15.
• [17] Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
• [18] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [19] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [20] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [21] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [22] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.