General Information of Drug Off-Target (DOT) (ID: OTQ52G7V)

DOT Name Potassium voltage-gated channel subfamily H member 6 (KCNH6)
Synonyms Ether-a-go-go-related gene potassium channel 2; ERG-2; Eag-related protein 2; Ether-a-go-go-related protein 2; hERG-2; hERG2; Voltage-gated potassium channel subunit Kv11.2
Gene Name KCNH6
Related Disease
Hyperglycemia ( )
Hyperinsulinemia ( )
Hypoglycemia ( )
Type-1/2 diabetes ( )
Adenoma ( )
Osteoporosis ( )
Psychotic disorder ( )
Schizophrenia ( )
Meningioma ( )
Endometrium adenocarcinoma ( )
UniProt ID
KCNH6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00027 ; PF00520 ; PF13426
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGAGK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFAESFWSKLEVTFNLRDAAGG
LHSSPRQAPGSQDHQGFFLSDNQSGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHP
DAAPPLSISDASGLWPELLQEMPPRHSPQSPQEDPDCWPLKLGSRLEQLQAQMNRLESRV
SSDLSRILQLLQKPMPQGHASYILEAPASNDLALVPIASETTSPGPRLPQGFLPPAQTPS
YGDLDDCSPKHRNSSPRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICG
PCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH
Function Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, rectifying current. Channel properties may be modulated by cAMP and subunit assembly.
Tissue Specificity Expressed in prolactin-secreting adenomas.
Reactome Pathway
Voltage gated Potassium channels (R-HSA-1296072 )

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hyperglycemia DIS0BZB5 Definitive Genetic Variation [1]
Hyperinsulinemia DISIDWT6 Definitive Genetic Variation [1]
Hypoglycemia DISRCKR7 Definitive Genetic Variation [1]
Type-1/2 diabetes DISIUHAP Definitive Genetic Variation [1]
Adenoma DIS78ZEV Strong Altered Expression [2]
Osteoporosis DISF2JE0 Strong Biomarker [3]
Psychotic disorder DIS4UQOT Strong Biomarker [4]
Schizophrenia DISSRV2N Strong Biomarker [4]
Meningioma DISPT4TG moderate Biomarker [5]
Endometrium adenocarcinoma DISY6744 Limited Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Potassium voltage-gated channel subfamily H member 6 (KCNH6). [7]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Potassium voltage-gated channel subfamily H member 6 (KCNH6). [8]
Testosterone DM7HUNW Approved Testosterone increases the expression of Potassium voltage-gated channel subfamily H member 6 (KCNH6). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Potassium voltage-gated channel subfamily H member 6 (KCNH6). [9]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Potassium voltage-gated channel subfamily H member 6 (KCNH6). [10]
------------------------------------------------------------------------------------

References

1 From Hyper- to Hypoinsulinemia and Diabetes: Effect of KCNH6 on Insulin Secretion.Cell Rep. 2018 Dec 26;25(13):3800-3810.e6. doi: 10.1016/j.celrep.2018.12.005.
2 HERG K(+) currents in human prolactin-secreting adenoma cells.Pflugers Arch. 2003 Feb;445(5):589-600. doi: 10.1007/s00424-002-0980-0. Epub 2002 Dec 6.
3 Significant pathways detection in osteoporosis based on the bibliometric network.Eur Rev Med Pharmacol Sci. 2013 Jan;17(1):1-7.
4 Two four-marker haplotypes on 7q36.1 region indicate that the potassium channel gene HERG1 (KCNH2, Kv11.1) is related to schizophrenia: a case control study.Behav Brain Funct. 2010 May 28;6:27. doi: 10.1186/1744-9081-6-27.
5 MicroRNA-224 targets ERG2 and contributes to malignant progressions of meningioma.Biochem Biophys Res Commun. 2015 May 1;460(2):354-61. doi: 10.1016/j.bbrc.2015.03.038. Epub 2015 Mar 14.
6 Selective expression of HERG and Kv2 channels influences proliferation of uterine cancer cells.Int J Oncol. 2004 Jul;25(1):153-9.
7 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
8 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
9 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
10 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.