Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ5AL3F)

DOT Name DnaJ homolog subfamily C member 7 (DNAJC7)
Synonyms Tetratricopeptide repeat protein 2; TPR repeat protein 2
Gene Name DNAJC7
Related Disease
HIV infectious disease ( )
Amyotrophic lateral sclerosis ( )
UniProt ID
DNJC7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00226 ; PF13414 ; PF13432 ; PF13181
Sequence
MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFS
FEASGPGNFFFQFG
Function
Acts as a co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of chaperone substrates to early stages of chaperoning if further folding is required. In vitro, induces ATP-independent dissociation of HSP90 but not of HSP70 from the chaperone-substrate complexes. Recruits NR1I3 to the cytoplasm.
Reactome Pathway
Regulation of HSF1-mediated heat shock response (R-HSA-3371453 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
HIV infectious disease DISO97HC Strong Biomarker [1]
Amyotrophic lateral sclerosis DISF7HVM Limited Autosomal dominant [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [6]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [7]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [8]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [9]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [10]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [11]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [9]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [12]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [16]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of DnaJ homolog subfamily C member 7 (DNAJC7). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of DnaJ homolog subfamily C member 7 (DNAJC7). [13]
------------------------------------------------------------------------------------

References

1 Host cell gene expression during human immunodeficiency virus type 1 latency and reactivation and effects of targeting genes that are differentially expressed in viral latency.J Virol. 2004 Sep;78(17):9458-73. doi: 10.1128/JVI.78.17.9458-9473.2004.
2 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
3 Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
8 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
9 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
11 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
12 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
14 BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.
15 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
16 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
17 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.