Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ6GDL2)

• DOT Name: Translocon-associated protein subunit alpha (SSR1)
• Synonyms: TRAP-alpha; Signal sequence receptor subunit alpha; SSR-alpha
• Gene Name: SSR1
• Related Disease:
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast carcinoma in situ
  Carcinoma of esophagus
  Esophageal cancer
  Neoplasm of esophagus
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Oral cancer
  Osteosarcoma
  Squamous cell carcinoma
  Medulloblastoma
  Primitive neuroectodermal tumor
  Advanced cancer
• UniProt ID: SSRA_HUMAN
• PDB ID: 8B6L
• Pfam ID: PF03896
• Sequence:
  MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDE
  PTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESL
  DASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDL
  NGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQK
  VEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
• Function: TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.
• KEGG Pathway: Protein processing in endoplasmic reticulum (hsa04141)
• Reactome Pathway:
  XBP1(S) activates chaperone genes (R-HSA-381038)
  SRP-dependent cotranslational protein targeting to membrane (R-HSA-1799339)

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone osteosarcoma	DIST1004	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Breast carcinoma in situ	DISRN92I	Strong	Biomarker	[2]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[3]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[3]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[3]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[4]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[5]
Oral cancer	DISLD42D	Strong	Biomarker	[6]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[1]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[6]
Medulloblastoma	DISZD2ZL	moderate	Biomarker	[7]
Primitive neuroectodermal tumor	DISFHXHA	moderate	Altered Expression	[7]
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[8]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Translocon-associated protein subunit alpha (SSR1).	[9]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Translocon-associated protein subunit alpha (SSR1).	[10]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[11]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Translocon-associated protein subunit alpha (SSR1).	[12]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[14]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[15]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[16]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Translocon-associated protein subunit alpha (SSR1).	[17]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[18]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Translocon-associated protein subunit alpha (SSR1).	[19]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Translocon-associated protein subunit alpha (SSR1).	[20]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Translocon-associated protein subunit alpha (SSR1).	[11]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Translocon-associated protein subunit alpha (SSR1).	[21]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Translocon-associated protein subunit alpha (SSR1).	[22]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[24]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[25]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Translocon-associated protein subunit alpha (SSR1).	[9]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Translocon-associated protein subunit alpha (SSR1).	[26]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Translocon-associated protein subunit alpha (SSR1).	[23]

References

• [1] Biological importance of a polymorphic CA sequence within intron 1 of the epidermal growth factor receptor gene (EGFR) in high grade central osteosarcomas.Genes Chromosomes Cancer. 2008 Aug;47(8):657-64. doi: 10.1002/gcc.20571.
• [2] Modification of breast cancer risk in young women by a polymorphic sequence in the egfr gene.Cancer Res. 2004 Jan 1;64(1):7-12. doi: 10.1158/0008-5472.can-03-2623.
• [3] EGFR intron-1 CA repeat polymorphism is a predictor of relapse and survival in complete resected only surgically treated esophageal cancer.Target Oncol. 2014 Mar;9(1):43-52. doi: 10.1007/s11523-013-0260-2. Epub 2013 Feb 2.
• [4] Requirement for translocon-associated protein (TRAP) in insulin biogenesis.Sci Adv. 2019 Dec 4;5(12):eaax0292. doi: 10.1126/sciadv.aax0292. eCollection 2019 Dec.
• [5] EGFR polymorphism as a predictor of clinical outcome in advanced lung cancer patients treated with EGFR-TKI.Yonsei Med J. 2012 Nov 1;53(6):1128-35. doi: 10.3349/ymj.2012.53.6.1128.
• [6] Lack of evidence for prognostic value of epidermal growth factor receptor intron-1 CA repeats for oral carcinomas.Eur J Oral Sci. 2017 Apr;125(2):95-101. doi: 10.1111/eos.12333. Epub 2017 Feb 2.
• [7] Differential expression of somatostatin receptors, P44/42 MAPK, and mTOR activation in medulloblastomas and primitive neuroectodermal tumors.Appl Immunohistochem Mol Morphol. 2013 Dec;21(6):532-8. doi: 10.1097/PAI.0b013e3182813724.
• [8] CA-SSR1 Polymorphism in Intron 1 of the EGFR Gene in Patients with Malignant Tumors Who Develop Acneiform Rash Associated with the Use of Cetuximab.Mol Diagn Ther. 2015 Apr;19(2):79-89. doi: 10.1007/s40291-015-0132-9.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [10] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [11] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [12] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [13] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [14] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [15] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [16] Influence of Iron on Cytotoxicity and Gene Expression Profiles Induced by Arsenic in HepG2 Cells. Int J Environ Res Public Health. 2019 Nov 14;16(22):4484. doi: 10.3390/ijerph16224484.
• [17] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [18] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [19] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [20] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [21] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [22] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [23] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [24] Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
• [25] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [26] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.