Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQEJWSA)

• DOT Name: Basic immunoglobulin-like variable motif-containing protein (BIVM)
• Gene Name: BIVM
• Related Disease: Bipolar disorder
• UniProt ID: BIVM_HUMAN
• Sequence:
  MPNVAETERSNDSGNGEHKSERKSPEENLQGAVKSFCTSASGAPLGPKGDGHYPWSCPVT
  HTREKIYAICSDYAFLNQATSIYKTPNPSRSPCLPDSTSLSAGNNSSRYIGIPTSTSEII
  YNEENSLENLSNSLGKLPLAWEIDKSEFDGVTTNSKHKSGNAKKQVSKRKTSDKKGRYQK
  ECPQHSPLEDIKQRKVLDLRRWYCISRPQYKTSCGISSLISCWNFLYSTMGAGNLPPITQ
  EEALHILGFQPPFEDIRFGPFTGNTTLMRWFRQINDHFHVKGCSYVLYKPHGKNKTAGET
  ASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEATPVKANKAFSRGPLSPQEVEYWILI
  GESSRKHPAIHCKKWADIVTDLNTQNPEYLDIRHLERGLQYRKTKKVGGNLHCIIAFQRL
  NWQRFGLWNFPFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK
  KMSSIHERRNSGYQGYSDYDGND
• Tissue Specificity: Widely expressed. Expressed at higher level in spleen, ovary, small intestine, colon, peripheral blood leukocytes and liver. Also expressed in testis, ovary, aorta, appendix, trachea, pituitary gland, bladder, uterus, spinal cord, salivary gland, stomach, mammary gland and bone marrow. Weakly or not expressed in fetal spleen, adult thymus and certain cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bipolar disorder	DISAM7J2	Strong	Biomarker	[1]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[7]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[11]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[12]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[13]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Basic immunoglobulin-like variable motif-containing protein (BIVM).	[15]

References

• [1] Linkage disequilibrium analysis in the LOC93081-KDELC1-BIVM region on 13q in bipolar disorder.Am J Med Genet B Neuropsychiatr Genet. 2005 Feb 5;133B(1):12-7. doi: 10.1002/ajmg.b.30121.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [12] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [13] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [14] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [15] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.