Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQRDBY6)

DOT Name G patch domain-containing protein 1 (GPATCH1)
Synonyms Evolutionarily conserved G-patch domain-containing protein
Gene Name GPATCH1
Related Disease
Colon cancer ( )
Colorectal adenocarcinoma ( )
Colorectal cancer ( )
Colorectal cancer, susceptibility to, 1 ( )
Colorectal cancer, susceptibility to, 10 ( )
Colorectal cancer, susceptibility to, 12 ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Osteoporosis ( )
UniProt ID
GPTC1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07713 ; PF01585
Sequence
MAARDSDSEEDLVSYGTGLEPLEEGERPKKPIPLQDQTVRDEKGRYKRFHGAFSGGFSAG
YFNTVGSKEGWTPSTFVSSRQNRADKSVLGPEDFMDEEDLSEFGIAPKAIVTTDDFASKT
KDRIREKARQLAAATAPIPGATLLDDLITPAKLSVGFELLRKMGWKEGQGVGPRVKRRPR
RQKPDPGVKIYGCALPPGSSEGSEGEDDDYLPDNVTFAPKDVTPVDFTPKDNVHGLAYKG
LDPHQALFGTSGEHFNLFSGGSERAGDLGEIGLNKGRKLGISGQAFGVGALEEEDDDIYA
TETLSKYDTVLKDEEPGDGLYGWTAPRQYKNQKESEKDLRYVGKILDGFSLASKPLSSKK
IYPPPELPRDYRPVHYFRPMVAATSENSHLLQVLSESAGKATPDPGTHSKHQLNASKRAE
LLGETPIQGSATSVLEFLSQKDKERIKEMKQATDLKAAQLKARSLAQNAQSSRAQLSPAA
AAGHCSWNMALGGGTATLKASNFKPFAKDPEKQKRYDEFLVHMKQGQKDALERCLDPSMT
EWERGRERDEFARAALLYASSHSTLSSRFTHAKEEDDSDQVEVPRDQENDVGDKQSAVKM
KMFGKLTRDTFEWHPDKLLCKRFNVPDPYPDSTLVGLPRVKRDKYSVFNFLTLPETASLP
TTQASSEKVSQHRGPDKSRKPSRWDTSKHEKKEDSISEFLSLARSKAEPPKQQSSPLVNK
EEEHAPELSANQTVNKDVDAQAEGEGSRPSMDLFRAIFASSSDEKSSSSEDEQGDSEDDQ
AGSGEANFQSSQDTDLGETSSVAHALVPAPQEPPPSFPIQKMQIDEREEFGPRLPPVFCP
NARQTLEVPQKEKHKKNKDKHKAKKEHRRKKEKKKKHRKHKHKGKQKNKKPEKSSSSESS
DSSDSQSDEETADVSPQELLRRLKSLPLRRQ
Reactome Pathway
mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colon cancer DISVC52G Strong Genetic Variation [1]
Colorectal adenocarcinoma DISPQOUB Strong Genetic Variation [1]
Colorectal cancer DISNH7P9 Strong Genetic Variation [1]
Colorectal cancer, susceptibility to, 1 DISZ794C Strong Genetic Variation [1]
Colorectal cancer, susceptibility to, 10 DISQXMYM Strong Genetic Variation [1]
Colorectal cancer, susceptibility to, 12 DIS4FXJX Strong Genetic Variation [1]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [1]
Colorectal neoplasm DISR1UCN Strong Genetic Variation [1]
Osteoporosis DISF2JE0 Strong Genetic Variation [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of G patch domain-containing protein 1 (GPATCH1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of G patch domain-containing protein 1 (GPATCH1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of G patch domain-containing protein 1 (GPATCH1). [5]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of G patch domain-containing protein 1 (GPATCH1). [8]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of G patch domain-containing protein 1 (GPATCH1). [9]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of G patch domain-containing protein 1 (GPATCH1). [6]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of G patch domain-containing protein 1 (GPATCH1). [7]
------------------------------------------------------------------------------------

References

1 Novel colon cancer susceptibility variants identified from a genome-wide association study in African Americans.Int J Cancer. 2017 Jun 15;140(12):2728-2733. doi: 10.1002/ijc.30687. Epub 2017 Mar 28.
2 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.Hum Mol Genet. 2014 Jun 1;23(11):3054-68. doi: 10.1093/hmg/ddt675. Epub 2014 Jan 14.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
8 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
9 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.