Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQRML29)

• DOT Name: Oncomodulin-1 (OCM)
• Synonyms: OM; Parvalbumin beta
• Gene Name: OCM
• Related Disease:
  Alzheimer disease
  Chromosomal disorder
  Hepatocellular carcinoma
  Neoplasm
  Non-hodgkin lymphoma
  Parkinson disease
  Metastatic malignant neoplasm
  Advanced cancer
  Melanoma
  Uveal Melanoma
• UniProt ID: ONCO_HUMAN
• PDB ID: 1TTX
• Pfam ID: PF13499
• Sequence:
  MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLD
  EEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
• Function: Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[3]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[5]
Parkinson disease	DISQVHKL	Strong	Biomarker	[6]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[7]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[8]
Melanoma	DIS1RRCY	Limited	Biomarker	[9]
Uveal Melanoma	DISA7ZGL	Limited	Biomarker	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Oncomodulin-1 (OCM).	[11]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Oncomodulin-1 (OCM).	[13]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Oncomodulin-1 (OCM).	[12]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Oncomodulin-1 (OCM).	[14]

References

• [1] Structural Basis for Achieving GSK-3 Inhibition with High Potency, Selectivity, and Brain Exposure for Positron Emission Tomography Imaging and Drug Discovery.J Med Chem. 2019 Nov 14;62(21):9600-9617. doi: 10.1021/acs.jmedchem.9b01030. Epub 2019 Oct 21.
• [2] Establishment and characterization of primary and metastatic uveal melanoma cell lines.Int J Cancer. 1996 May 3;66(3):380-7. doi: 10.1002/(SICI)1097-0215(19960503)66:3<380::AID-IJC19>3.0.CO;2-F.
• [3] Donor onecarbon metabolism gene single nucleotide polymorphisms predict the susceptibility of cancer recurrence after liver transplantation.Gene. 2019 Mar 20;689:97-101. doi: 10.1016/j.gene.2018.11.035. Epub 2018 Dec 7.
• [4] Quantitative Evaluation of Vascular Microcirculation Using Contrast-Enhanced Ultrasound Imaging In Rabbit Models of Choroidal Melanoma.Invest Ophthalmol Vis Sci. 2018 Mar 1;59(3):1251-1262. doi: 10.1167/iovs.17-22197.
• [5] Genetic polymorphisms in the one-carbon metabolism pathway genes and susceptibility to non-Hodgkin lymphoma.Tumour Biol. 2015 Mar;36(3):1819-34. doi: 10.1007/s13277-014-2785-0. Epub 2014 Nov 11.
• [6] Abundant fish protein inhibits -synuclein amyloid formation.Sci Rep. 2018 Apr 3;8(1):5465. doi: 10.1038/s41598-018-23850-0.
• [7] Nodal occult metastases in intermediate- and high-risk prostate cancer patients detected using serial section, immunohistochemistry, and real-time reverse transcriptase polymerase chain reaction: prospective evaluation with matched-pair analysis.Clin Genitourin Cancer. 2015 Apr;13(2):e55-64. doi: 10.1016/j.clgc.2014.08.004. Epub 2014 Aug 9.
• [8] Expression of natural killer cell regulatory microRNA by uveal melanoma cancer stem cells.Clin Exp Metastasis. 2016 Dec;33(8):829-838. doi: 10.1007/s10585-016-9815-9. Epub 2016 Aug 26.
• [9] The effect of dielectrophoresis on living cells: crossover frequencies and deregulation in gene expression.Analyst. 2019 Jun 21;144(12):3853-3860. doi: 10.1039/c9an00320g. Epub 2019 May 17.
• [10] Characterization of luteinizing hormone-releasing hormone receptor type I (LH-RH-I) as a potential molecular target in OCM-1 and OCM-3 human uveal melanoma cell lines.Onco Targets Ther. 2018 Feb 22;11:933-941. doi: 10.2147/OTT.S148174. eCollection 2018.
• [11] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [12] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [13] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [14] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.