Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRYI60X)

DOT Name Magnesium transporter NIPA3 (NIPAL1)
Synonyms NIPA-like protein 1; Non-imprinted in Prader-Willi/Angelman syndrome region protein 3
Gene Name NIPAL1
Related Disease
Advanced cancer ( )
Retinitis pigmentosa 49 ( )
Squamous cell carcinoma ( )
Uterine fibroids ( )
Cone-rod dystrophy ( )
Epstein barr virus infection ( )
Gout ( )
Nasopharyngeal carcinoma ( )
Retinitis pigmentosa ( )
UniProt ID
NIPA3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05653
Sequence
MGAQVRLPPGEPCREGYVLSLVCPNSSQAWCEITNVSQLLASPVLYTDLNYSINNLSISA
NVENKYSLYVGLVLAVSSSIFIGSSFILKKKGLLQLASKGFTRAGQGGHSYLKEWLWWVG
LLSMGAGEAANFAAYAFAPATLVTPLGALSVLISAILSSYFLNEHLNIHGKIGCILSILG
STVMVIHAPQEEEVTSLHEMEMKLRDPGFISFAVIITVISLVLILIVAPKKGQTNILVYI
SICSLIGAFSVSSVKGLGIAIKELIEWKPVYKHPLVFVLLAVLVLSVTTQINYLNKALDT
FNTSLVTPIYYVFFTSMVVTCSAILFQEWYGMTAGDIIGTLSGFFTIIIGIFLLHAFKNT
DITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD
Function Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+), Cu(2+) and Co(2+) but to a much less extent than Mg(2+).
Tissue Specificity Expressed in the pancreatic islets.
Reactome Pathway
Miscellaneous transport and binding events (R-HSA-5223345 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Retinitis pigmentosa 49 DISRDSES Strong CausalMutation [2]
Squamous cell carcinoma DISQVIFL Strong Biomarker [1]
Uterine fibroids DISBZRMJ Strong Genetic Variation [3]
Cone-rod dystrophy DISY9RWN Limited Genetic Variation [4]
Epstein barr virus infection DISOO0WT Limited Biomarker [5]
Gout DISHC0U7 Limited Genetic Variation [6]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [5]
Retinitis pigmentosa DISCGPY8 Limited Genetic Variation [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Magnesium transporter NIPA3 (NIPAL1). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Magnesium transporter NIPA3 (NIPAL1). [11]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Magnesium transporter NIPA3 (NIPAL1). [8]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Magnesium transporter NIPA3 (NIPAL1). [9]
Marinol DM70IK5 Approved Marinol decreases the expression of Magnesium transporter NIPA3 (NIPAL1). [10]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Magnesium transporter NIPA3 (NIPAL1). [12]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Magnesium transporter NIPA3 (NIPAL1). [13]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Magnesium transporter NIPA3 (NIPAL1). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 NIPA-like domain containing 1 is a novel tumor-promoting factor in oral squamous cell carcinoma.J Cancer Res Clin Oncol. 2018 May;144(5):875-882. doi: 10.1007/s00432-018-2612-x. Epub 2018 Feb 20.
2 Whole exome analysis identifies frequent CNGA1 mutations in Japanese population with autosomal recessive retinitis pigmentosa. PLoS One. 2014 Sep 30;9(9):e108721. doi: 10.1371/journal.pone.0108721. eCollection 2014.
3 Variants associating with uterine leiomyoma highlight genetic background shared by various cancers and hormone-related traits.Nat Commun. 2018 Sep 7;9(1):3636. doi: 10.1038/s41467-018-05428-6.
4 Molecular genetic analysis using targeted NGS analysis of 677 individuals with retinal dystrophy.Sci Rep. 2019 Feb 4;9(1):1219. doi: 10.1038/s41598-018-38007-2.
5 Whole-Exome Sequencing of Nasopharyngeal Carcinoma Families Reveals Novel Variants Potentially Involved in Nasopharyngeal Carcinoma.Sci Rep. 2019 Jul 9;9(1):9916. doi: 10.1038/s41598-019-46137-4.
6 GWAS of clinically defined gout and subtypes identifies multiple susceptibility loci that include urate transporter genes.Ann Rheum Dis. 2017 May;76(5):869-877. doi: 10.1136/annrheumdis-2016-209632. Epub 2016 Nov 29.
7 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
8 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
9 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
10 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
13 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
14 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.