Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSMXQRJ)

• DOT Name: Serpin B5 (SERPINB5)
• Synonyms: Maspin; Peptidase inhibitor 5; PI-5
• Gene Name: SERPINB5
• UniProt ID: SPB5_HUMAN
• PDB ID: 1WZ9; 1XQG; 1XQJ; 1XU8
• Pfam ID: PF00079
• Sequence:
  MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF
  ENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVD
  FKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESET
  KECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDES
  TGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSED
  TSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRH
  NKTRNIIFFGKFCSP
• Function: Tumor suppressor. It blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
• Tissue Specificity: Normal mammary epithelial cells.
• KEGG Pathway:
  p53 sig.ling pathway (hsa04115)
  MicroR.s in cancer (hsa05206)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Serpin B5 (SERPINB5) decreases the response to substance of Arsenic trioxide.	[24]
Deoxycholic acid	DM3GYAL	Approved	Serpin B5 (SERPINB5) decreases the response to substance of Deoxycholic acid.	[25]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Serpin B5 (SERPINB5).	[1]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the methylation of Serpin B5 (SERPINB5).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Serpin B5 (SERPINB5).	[19]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Serpin B5 (SERPINB5).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Serpin B5 (SERPINB5).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Serpin B5 (SERPINB5).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Serpin B5 (SERPINB5).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Serpin B5 (SERPINB5).	[6]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Serpin B5 (SERPINB5).	[7]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Serpin B5 (SERPINB5).	[5]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Serpin B5 (SERPINB5).	[9]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Serpin B5 (SERPINB5).	[10]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Serpin B5 (SERPINB5).	[11]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Serpin B5 (SERPINB5).	[11]
2-deoxyglucose	DMIAHVU	Approved	2-deoxyglucose increases the expression of Serpin B5 (SERPINB5).	[12]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Serpin B5 (SERPINB5).	[13]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Serpin B5 (SERPINB5).	[14]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Serpin B5 (SERPINB5).	[15]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin increases the expression of Serpin B5 (SERPINB5).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Serpin B5 (SERPINB5).	[17]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Serpin B5 (SERPINB5).	[18]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Serpin B5 (SERPINB5).	[20]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Serpin B5 (SERPINB5).	[21]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone decreases the expression of Serpin B5 (SERPINB5).	[22]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Serpin B5 (SERPINB5).	[23]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [3] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [4] Genome-wide analysis of BEAS-2B cells exposed to trivalent arsenicals and dimethylthioarsinic acid. Toxicology. 2010 Jan 31;268(1-2):31-9.
• [5] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [8] Effects of 5-Aza-CdR on cell proliferation of breast cancer cell line MDA-MB-435S and expression of maspin gene. J Huazhong Univ Sci Technolog Med Sci. 2007 Oct;27(5):543-6. doi: 10.1007/s11596-007-0517-z.
• [9] Apoptosis, cell cycle progression and gene expression in TP53-depleted HCT116 colon cancer cells in response to short-term 5-fluorouracil treatment. Int J Oncol. 2007 Dec;31(6):1491-500.
• [10] Restoration by aspirin of impaired plasma maspin level in human breast cancer. Acta Oncol. 2006;45(2):184-7. doi: 10.1080/02841860500516584.
• [11] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [12] IKK inibition by a glucosamine derivative enhances Maspin expression in osteosarcoma cell line. Chem Biol Interact. 2017 Jan 25;262:19-28. doi: 10.1016/j.cbi.2016.12.005. Epub 2016 Dec 6.
• [13] Resveratrol reduces prostate cancer growth and metastasis by inhibiting the Akt/MicroRNA-21 pathway. PLoS One. 2012;7(12):e51655. doi: 10.1371/journal.pone.0051655. Epub 2012 Dec 13.
• [14] Mechanisms of DNA methyltransferase-inhibitor interactions: Procyanidin B2 shows new promise for therapeutic intervention of cancer. Chem Biol Interact. 2015 May 25;233:122-38. doi: 10.1016/j.cbi.2015.03.022. Epub 2015 Mar 31.
• [15] [Up-regulates the expression of maspin gene in prostate cancer cell line LNCaP]. Yao Xue Xue Bao. 2006 Dec;41(12):1152-6.
• [16] Candidate therapeutic agents for hepatocellular cancer can be identified from phenotype-associated gene expression signatures. Cancer. 2009 Aug 15;115(16):3738-48. doi: 10.1002/cncr.24417.
• [17] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [18] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [19] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [20] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [21] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [22] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [23] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [24] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.
• [25] Development and molecular characterization of HCT-116 cell lines resistant to the tumor promoter and multiple stress-inducer, deoxycholate. Carcinogenesis. 2002 Dec;23(12):2063-80. doi: 10.1093/carcin/23.12.2063.