Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSWUMXT)

• DOT Name: Coiled-coil domain-containing protein 28A (CCDC28A)
• Synonyms: CCRL1AP
• Gene Name: CCDC28A
• Related Disease:
  Acute megakaryoblastic leukemia
  Childhood acute megakaryoblastic leukemia
  Myeloid leukaemia
  Acute leukaemia
  Myeloid neoplasm
  Myeloproliferative neoplasm
  T-cell acute lymphoblastic leukaemia
• UniProt ID: CC28A_HUMAN
• Pfam ID: PF13270
• Sequence:
  MPRAEPRATLGEQEKAGLPLGAWRLYLLRHFRKQTELRRSGSRDVTGALLVAAAVASEAV
  GSLRVAEGGPNTLLLQVLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIP
  VSKSTGFSNPASQSTSQRPKLKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMER
  GLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASD
  SNLDRLLSDLEELNSSIQKLHLADAQDVPNTSAS

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute megakaryoblastic leukemia	DIS0JX3M	Strong	Genetic Variation	[1]
Childhood acute megakaryoblastic leukemia	DIS5VZDR	Strong	Genetic Variation	[1]
Myeloid leukaemia	DISMN944	Strong	Biomarker	[1]
Acute leukaemia	DISDQFDI	Limited	Biomarker	[2]
Myeloid neoplasm	DIS2YOWO	Limited	Biomarker	[2]
Myeloproliferative neoplasm	DIS5KAPA	Limited	Biomarker	[2]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Limited	Biomarker	[3]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[9]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[10]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[11]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Coiled-coil domain-containing protein 28A (CCDC28A).	[12]

References

• [1] Characterization of 6q abnormalities in childhood acute myeloid leukemia and identification of a novel t(6;11)(q24.1;p15.5) resulting in a NUP98-C6orf80 fusion in a case of acute megakaryoblastic leukemia.Genes Chromosomes Cancer. 2005 Nov;44(3):225-32. doi: 10.1002/gcc.20233.
• [2] Functional analysis of the NUP98-CCDC28A fusion protein.Haematologica. 2012 Mar;97(3):379-87. doi: 10.3324/haematol.2011.047969. Epub 2011 Nov 4.
• [3] NUP98 rearrangements in hematopoietic malignancies: a study of the Groupe Francophone de Cytogntique Hmatologique.Leukemia. 2006 Apr;20(4):696-706. doi: 10.1038/sj.leu.2404130.
• [4] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [5] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [6] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [11] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.