Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUQA9JT)

• DOT Name: RING finger protein 39 (RNF39)
• Synonyms: Protein HZFw
• Gene Name: RNF39
• Related Disease:
  Acquired immune deficiency syndrome
  Behcet disease
  HIV infectious disease
  Lung adenocarcinoma
  Myasthenia gravis
  Type-1 diabetes
  Systemic lupus erythematosus
  Coronary heart disease
  Lung cancer
• UniProt ID: RNF39_HUMAN
• Pfam ID: PF13765 ; PF00622 ; PF13445
• Sequence:
  MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
  AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
  ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
  MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
  LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
  GEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEP
  PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES
• Function: May play a role in prolonged long term-potentiation (LTP) maintenance.
• Tissue Specificity: Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acquired immune deficiency syndrome	DISL5UOX	Strong	Genetic Variation	[1]
Behcet disease	DISSYMBS	Strong	Biomarker	[2]
HIV infectious disease	DISO97HC	Strong	Genetic Variation	[3]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[4]
Myasthenia gravis	DISELRCI	Strong	Genetic Variation	[5]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[6]
Systemic lupus erythematosus	DISI1SZ7	moderate	Genetic Variation	[7]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[8]
Lung cancer	DISCM4YA	Limited	Genetic Variation	[9]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of RING finger protein 39 (RNF39).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of RING finger protein 39 (RNF39).	[11]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of RING finger protein 39 (RNF39).	[10]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of RING finger protein 39 (RNF39).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of RING finger protein 39 (RNF39).	[13]

References

• [1] Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).J Infect Dis. 2009 Feb 1;199(3):419-26. doi: 10.1086/596067.
• [2] TRIM39 and RNF39 are associated with Behet's disease independently of HLA-B?1 and -A?6.Biochem Biophys Res Commun. 2010 Oct 29;401(4):533-7. doi: 10.1016/j.bbrc.2010.09.088. Epub 2010 Sep 27.
• [3] The HLA-B/-C haplotype block contains major determinants for host control of HIV.Genes Immun. 2009 Dec;10(8):673-7. doi: 10.1038/gene.2009.58. Epub 2009 Aug 20.
• [4] A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.Am J Hum Genet. 2009 Nov;85(5):679-91. doi: 10.1016/j.ajhg.2009.09.012. Epub 2009 Oct 15.
• [5] Risk for myasthenia gravis maps to a (151) ProAla change in TNIP1 and to human leukocyte antigen-B*08.Ann Neurol. 2012 Dec;72(6):927-35. doi: 10.1002/ana.23691. Epub 2012 Oct 10.
• [6] A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
• [7] GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.Genes Immun. 2014 Sep;15(6):347-54. doi: 10.1038/gene.2014.23. Epub 2014 May 29.
• [8] Genetic loci associated with nonobstructive coronary artery disease in Caucasian women.Physiol Genomics. 2016 Jan;48(1):12-20. doi: 10.1152/physiolgenomics.00067.2015. Epub 2015 Nov 3.
• [9] Influence of common genetic variation on lung cancer risk: meta-analysis of 14 900 cases and 29 485 controls.Hum Mol Genet. 2012 Nov 15;21(22):4980-95. doi: 10.1093/hmg/dds334. Epub 2012 Aug 16.
• [10] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [11] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [12] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [13] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.