Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUXZGDQ)

• DOT Name: Transgelin-2 (TAGLN2)
• Synonyms: Epididymis tissue protein Li 7e; SM22-alpha homolog
• Gene Name: TAGLN2
• UniProt ID: TAGL2_HUMAN
• PDB ID: 1WYM
• Pfam ID: PF00402 ; PF00307
• Sequence:
  MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT
  VLCELINALYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK
  NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGT
  NRGASQAGMTGYGMPRQIL
• Tissue Specificity: Expressed in epididymis (at protein level).
• Reactome Pathway: Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transgelin-2 (TAGLN2).	[1]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transgelin-2 (TAGLN2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transgelin-2 (TAGLN2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transgelin-2 (TAGLN2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transgelin-2 (TAGLN2).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Transgelin-2 (TAGLN2).	[6]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Transgelin-2 (TAGLN2).	[7]
Selenium	DM25CGV	Approved	Selenium increases the expression of Transgelin-2 (TAGLN2).	[8]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Transgelin-2 (TAGLN2).	[9]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Transgelin-2 (TAGLN2).	[10]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Transgelin-2 (TAGLN2).	[11]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Transgelin-2 (TAGLN2).	[12]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Transgelin-2 (TAGLN2).	[10]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Transgelin-2 (TAGLN2).	[10]
Haloperidol	DM96SE0	Approved	Haloperidol decreases the expression of Transgelin-2 (TAGLN2).	[10]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transgelin-2 (TAGLN2).	[14]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Transgelin-2 (TAGLN2).	[15]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transgelin-2 (TAGLN2).	[16]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transgelin-2 (TAGLN2).	[17]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Transgelin-2 (TAGLN2).	[18]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Transgelin-2 (TAGLN2).	[19]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transgelin-2 (TAGLN2).	[20]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Transgelin-2 (TAGLN2).	[21]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Transgelin-2 (TAGLN2).	[22]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A affects the expression of Transgelin-2 (TAGLN2).	[23]
Manganese	DMKT129	Investigative	Manganese decreases the expression of Transgelin-2 (TAGLN2).	[24]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Transgelin-2 (TAGLN2).	[13]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [8] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [11] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [12] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [13] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [14] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [15] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [16] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [17] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [18] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [19] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [20] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [21] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [22] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [23] Lipid Rafts Disruption Increases Ochratoxin A Cytotoxicity to Hepatocytes. J Biochem Mol Toxicol. 2016 Feb;30(2):71-9. doi: 10.1002/jbt.21738. Epub 2015 Aug 25.
• [24] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.