Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVLD4J3)

• DOT Name: Serine-rich coiled-coil domain-containing protein 1 (CCSER1)
• Synonyms: Coiled-coil serine-rich protein 1
• Gene Name: CCSER1
• Related Disease:
  Chronic renal failure
  Advanced cancer
  Cocaine addiction
  Malignant mesothelioma
  Pancreatic cancer
  Alcohol dependence
  Alcohol-induced disorders
  Alcohol-related disorders
• UniProt ID: CCSE1_HUMAN
• Sequence:
  MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRR
  SIFRTPSISFHHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS
  SSRNKKITRSLTEDFEREKEHSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKL
  LPKSFSSHYKFSKPVLQSQSISLVQQSEFSLEVTQYQEREPVLVRASPSCSVDVTERAGS
  SLQSPLLSADLTTAQTPSEFLALTEDSVSEMDAFSKSGSMASHCDNFGHNDSTSQMSLNS
  AAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLLQIAELPATSV
  SHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIP
  TSGDHHIFNKTSHGYEANPAKVLASSLSPFREGRFIERRLRSSSEGTAGSSRMILKPKDG
  NIEEVNSLRKQRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDS
  YHSVVSCAAVVLTPMEPMIEMKKREEPEFPEPSKQNLSLKLTKDVDQEARCSHISRMPNS
  PSADWPLQGVEENGGIDSLPFRLMLQDCTAVKTLLLKMKRVLQESADMSPASSTTSLPVS
  PLTEEPVPFKDIMKDECSMLKLQLKEKDELISQLQEELGKVRHLQKAFASRVDKSTQTEL
  LCYDGLNLKRLETVQGGREATYRNRIVSQNLSTRDRKAIHTPTEDRFRYSAADQTSPYKN
  KTCQLPSLCLSNFLKDKELAEVIKHSRGTYETLTSDVTQNLRATVGQSSLKPTAKTEGLS
  TFLEKPKDQVATARQHSTFTGRFGQPPRGPISLHMYSRKNVFLHHNLHSTELQTLGQQDG

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic renal failure	DISGG7K6	Definitive	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Cocaine addiction	DISHTRXG	Strong	Biomarker	[3]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[4]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[2]
Alcohol dependence	DIS4ZSCO	moderate	Genetic Variation	[5]
Alcohol-induced disorders	DIS3SFYT	moderate	Genetic Variation	[5]
Alcohol-related disorders	DIS3K4KK	moderate	Genetic Variation	[5]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cocaine	DMSOX7I	Approved	Serine-rich coiled-coil domain-containing protein 1 (CCSER1) affects the response to substance of Cocaine.	[3]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Serine-rich coiled-coil domain-containing protein 1 (CCSER1).	[6]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Serine-rich coiled-coil domain-containing protein 1 (CCSER1).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Serine-rich coiled-coil domain-containing protein 1 (CCSER1).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Serine-rich coiled-coil domain-containing protein 1 (CCSER1).	[11]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Serine-rich coiled-coil domain-containing protein 1 (CCSER1).	[7]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Serine-rich coiled-coil domain-containing protein 1 (CCSER1).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Serine-rich coiled-coil domain-containing protein 1 (CCSER1).	[12]

References

• [1] Sex-specific and pleiotropic effects underlying kidney function identified from GWAS meta-analysis.Nat Commun. 2019 Apr 23;10(1):1847. doi: 10.1038/s41467-019-09861-z.
• [2] FAM190A deficiency creates a cell division defect.Am J Pathol. 2013 Jul;183(1):296-303. doi: 10.1016/j.ajpath.2013.03.020. Epub 2013 May 10.
• [3] Substance dependence low-density whole genome association study in two distinct American populations. Hum Genet. 2008 Jun;123(5):495-506. doi: 10.1007/s00439-008-0501-0. Epub 2008 Apr 26.
• [4] Integrated high-resolution array CGH and SKY analysis of homozygous deletions and other genomic alterations present in malignant mesothelioma cell lines.Cancer Genet. 2013 May;206(5):191-205. doi: 10.1016/j.cancergen.2013.04.006. Epub 2013 Jul 5.
• [5] Ancestry-specific and sex-specific risk alleles identified in a genome-wide gene-by-alcohol dependence interaction study of risky sexual behaviors.Am J Med Genet B Neuropsychiatr Genet. 2017 Dec;174(8):846-853. doi: 10.1002/ajmg.b.32604. Epub 2017 Oct 9.
• [6] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [7] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [8] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [9] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [12] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [13] Substance dependence low-density whole genome association study in two distinct American populations. Hum Genet. 2008 Jun;123(5):495-506. doi: 10.1007/s00439-008-0501-0. Epub 2008 Apr 26.