Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWGX2SD)

DOT Name	Melanoma-associated antigen 9 (MAGEA9)
Synonyms	Cancer/testis antigen 1.9; CT1.9; MAGE-9 antigen
Gene Name	MAGEA9
Related Disease	Neoplasm ( ) Clear cell renal carcinoma ( ) Renal cell carcinoma ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( )
UniProt ID	MAGA9_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF01454 ; PF12440
Sequence	MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEEVSAAGSSSPPQS PQGGASSSISVYYTLWSQFDEGSSSQEEEEPSSSVDPAQLEFMFQEALKLKVAELVHFLL HKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEFMQVIFGTDVKEVDPAGHSYILVTA LGLSCDSMLGDGHSMPKAALLIIVLGVILTKDNCAPEEVIWEALSVMGVYVGKEHMFYGE PRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKVINYLVMLNAREPICY PSLYEEVLGEEQEGV
Function	Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
Tissue Specificity	Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[2]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[2]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[3]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Melanoma-associated antigen 9 (MAGEA9).	[4]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Melanoma-associated antigen 9 (MAGEA9).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Melanoma-associated antigen 9 (MAGEA9).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Melanoma-associated antigen 9 (MAGEA9).	[7]
------------------------------------------------------------------------------------

References

1	Concomitant tumor and autoantigen vaccination supports renal cell carcinoma rejection.J Immunol. 2010 Jul 15;185(2):902-16. doi: 10.4049/jimmunol.0902683. Epub 2010 Jun 14.
2	Generation of RAGE-1 and MAGE-9 peptide-specific cytotoxic T-lymphocyte lines for transfer in patients with renal cell carcinoma.Int J Cancer. 2005 Nov 1;117(2):256-64. doi: 10.1002/ijc.21200.
3	MAGE-A9 mRNA and protein expression in bladder cancer.Int J Cancer. 2007 May 15;120(10):2170-7. doi: 10.1002/ijc.22282.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
6	Identification of estrogen-induced genes downregulated by AhR agonists in MCF-7 breast cancer cells using suppression subtractive hybridization. Gene. 2001 Jan 10;262(1-2):207-14. doi: 10.1016/s0378-1119(00)00530-8.
7	Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.