Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWVNFV4)

• DOT Name: START domain-containing protein 10 (STARD10)
• Synonyms: StARD10; Antigen NY-CO-28; PCTP-like protein; PCTP-L; Serologically defined colon cancer antigen 28; StAR-related lipid transfer protein 10
• Gene Name: STARD10
• Related Disease:
  Breast cancer
  Breast carcinoma
  Neoplasm
  Prostate cancer
  Prostate neoplasm
  Advanced cancer
  Non-insulin dependent diabetes
• UniProt ID: STA10_HUMAN
• PDB ID: 6SER
• Pfam ID: PF01852
• Sequence:
  MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVE
  MDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWR
  CPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKS
  CVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPE
  QSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT
• Function: May play metabolic roles in sperm maturation or fertilization. Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.
• Reactome Pathway: Synthesis of PC (R-HSA-1483191)

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[3]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[1]
Non-insulin dependent diabetes	DISK1O5Z	Disputed	Genetic Variation	[4]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of START domain-containing protein 10 (STARD10).	[5]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of START domain-containing protein 10 (STARD10).	[6]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of START domain-containing protein 10 (STARD10).	[7]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of START domain-containing protein 10 (STARD10).	[8]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of START domain-containing protein 10 (STARD10).	[9]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of START domain-containing protein 10 (STARD10).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of START domain-containing protein 10 (STARD10).	[11]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of START domain-containing protein 10 (STARD10).	[13]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of START domain-containing protein 10 (STARD10).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of START domain-containing protein 10 (STARD10).	[15]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of START domain-containing protein 10 (STARD10).	[16]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of START domain-containing protein 10 (STARD10).	[17]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of START domain-containing protein 10 (STARD10).	[18]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of START domain-containing protein 10 (STARD10).	[19]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of START domain-containing protein 10 (STARD10).	[12]

References

• [1] Star-related lipid transfer protein 10 (STARD10): a novel key player in alcohol-induced breast cancer progression.J Exp Clin Cancer Res. 2019 Jan 5;38(1):4. doi: 10.1186/s13046-018-1013-y.
• [2] Loss of STARD10 expression identifies a group of poor prognosis breast cancers independent of HER2/Neu and triple negative status.Int J Cancer. 2010 Mar 15;126(6):1445-53. doi: 10.1002/ijc.24826.
• [3] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [4] Decreased STARD10 Expression Is Associated with Defective Insulin Secretion in Humans and Mice.Am J Hum Genet. 2017 Feb 2;100(2):238-256. doi: 10.1016/j.ajhg.2017.01.011. Epub 2017 Jan 26.
• [5] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [8] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [9] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [10] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [11] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [14] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [15] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [16] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [17] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [18] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [19] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.