Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXR3KC9)

• DOT Name: Protein transport protein Sec24D (SEC24D)
• Synonyms: SEC24-related protein D
• Gene Name: SEC24D
• Related Disease:
  Advanced cancer
  Cole-Carpenter syndrome 2
  Glioma
  Hepatitis B virus infection
  Myocardial infarction
  Osteogenesis imperfecta
  Vascular purpura
  Cole-Carpenter syndrome
  Osteogenesis imperfecta type 1
  Epilepsy
• UniProt ID: SC24D_HUMAN
• PDB ID: 3EFO; 3EG9; 5KYU; 5KYW; 5KYX; 5KYY
• Pfam ID: PF00626 ; PF08033 ; PF04815 ; PF04811 ; PF04810
• Sequence:
  MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPG
  PPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSSYPGPISTSSVTQL
  GSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNG
  PGASPLPLPMYRPDGLSGPPPPNAQYQPPPLPGQTLGAGYPPQQANSGPQMAGAQLSYPG
  GFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDCM
  IQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESGP
  VRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLG
  SYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEET
  SAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLL
  DQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKK
  LVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYK
  YNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAA
  IDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSC
  ETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMK
  VLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKST
  MLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLP
  EVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFL
  CCVHKEICQLLN
• Function: Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules for their transport to the Golgi complex. Plays a central role in cargo selection within the COPII complex and together with SEC24C may have a different specificity compared to SEC24A and SEC24B. May more specifically package GPI-anchored proteins through the cargo receptor TMED10. May also be specific for IxM motif-containing cargos like the SNAREs GOSR2 and STX5.
• Tissue Specificity: Ubiquitously expressed, with higher amounts in placenta, pancreas, heart and liver.
• KEGG Pathway:
  Protein processing in endoplasmic reticulum (hsa04141)
  Pathogenic Escherichia coli infection (hsa05130)
• Reactome Pathway:
  COPII-mediated vesicle transport (R-HSA-204005)
  MHC class II antigen presentation (R-HSA-2132295)
  Cargo concentration in the ER (R-HSA-5694530)
  SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671)
  Antigen Presentation (R-HSA-983170)
  Regulation of cholesterol biosynthesis by SREBP (SREBF) (R-HSA-1655829)

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Cole-Carpenter syndrome 2	DIS77XHA	Strong	Autosomal recessive	[2]
Glioma	DIS5RPEH	Strong	Biomarker	[1]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[3]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[4]
Osteogenesis imperfecta	DIS7XQSD	Strong	Genetic Variation	[5]
Vascular purpura	DIS6ZZMF	Strong	Genetic Variation	[6]
Cole-Carpenter syndrome	DISTWF6O	Supportive	Autosomal dominant	[7]
Osteogenesis imperfecta type 1	DISPEDS3	Supportive	Autosomal dominant	[7]
Epilepsy	DISBB28L	Limited	Autosomal recessive	[8]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Bupropion	DM5PCS7	Approved	Protein transport protein Sec24D (SEC24D) increases the response to substance of Bupropion.	[29]
Ibogaine	DM3HJX7	Investigative	Protein transport protein Sec24D (SEC24D) increases the response to substance of Ibogaine.	[29]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein transport protein Sec24D (SEC24D).	[9]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein transport protein Sec24D (SEC24D).	[10]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein transport protein Sec24D (SEC24D).	[11]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein transport protein Sec24D (SEC24D).	[12]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein transport protein Sec24D (SEC24D).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein transport protein Sec24D (SEC24D).	[14]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein transport protein Sec24D (SEC24D).	[15]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein transport protein Sec24D (SEC24D).	[16]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Protein transport protein Sec24D (SEC24D).	[17]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Protein transport protein Sec24D (SEC24D).	[18]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Protein transport protein Sec24D (SEC24D).	[19]
Orlistat	DMRJSP8	Approved	Orlistat increases the expression of Protein transport protein Sec24D (SEC24D).	[20]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Protein transport protein Sec24D (SEC24D).	[21]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein transport protein Sec24D (SEC24D).	[18]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Protein transport protein Sec24D (SEC24D).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein transport protein Sec24D (SEC24D).	[16]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein transport protein Sec24D (SEC24D).	[23]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein transport protein Sec24D (SEC24D).	[25]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Protein transport protein Sec24D (SEC24D).	[26]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein transport protein Sec24D (SEC24D).	[27]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Protein transport protein Sec24D (SEC24D).	[28]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Protein transport protein Sec24D (SEC24D).	[24]

References

• [1] Identification of the potential biomarkers in patients with glioma: a weighted gene co-expression network analysis.Carcinogenesis. 2020 Jul 10;41(6):743-750. doi: 10.1093/carcin/bgz194.
• [2] Disruption of the Sec24d gene results in early embryonic lethality in the mouse. PLoS One. 2013 Apr 15;8(4):e61114. doi: 10.1371/journal.pone.0061114. Print 2013.
• [3] Identification and characterization of SEC24D as a susceptibility gene for hepatitis B virus infection.Sci Rep. 2019 Sep 17;9(1):13425. doi: 10.1038/s41598-019-49777-8.
• [4] Genome-wide association study of perioperative myocardial infarction after coronary artery bypass surgery.BMJ Open. 2015 May 6;5(5):e006920. doi: 10.1136/bmjopen-2014-006920.
• [5] Japanese patient with Cole-carpenter syndrome with compound heterozygous variants of SEC24D.Am J Med Genet A. 2018 Dec;176(12):2882-2886. doi: 10.1002/ajmg.a.40643. Epub 2018 Nov 21.
• [6] TECPR2 Cooperates with LC3C to Regulate COPII-Dependent ER Export.Mol Cell. 2015 Oct 1;60(1):89-104. doi: 10.1016/j.molcel.2015.09.010.
• [7] Mutations in SEC24D, encoding a component of the COPII machinery, cause a syndromic form of osteogenesis imperfecta. Am J Hum Genet. 2015 Mar 5;96(3):432-9. doi: 10.1016/j.ajhg.2015.01.002. Epub 2015 Feb 12.
• [8] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [9] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [10] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [11] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [12] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [13] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [14] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [15] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [16] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [17] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [18] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [19] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [20] Inhibition of fatty-acid synthase induces caspase-8-mediated tumor cell apoptosis by up-regulating DDIT4. J Biol Chem. 2008 Nov 14;283(46):31378-84. doi: 10.1074/jbc.M803384200. Epub 2008 Sep 16.
• [21] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [22] Using DNA microarray analyses to elucidate the effects of genistein in androgen-responsive prostate cancer cells: identification of novel targets. Mol Carcinog. 2004 Oct;41(2):108-119.
• [23] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [24] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [25] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [26] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [27] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [28] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [29] Pharmacological Chaperones of the Dopamine Transporter Rescue Dopamine Transporter Deficiency Syndrome Mutations in Heterologous Cells. J Biol Chem. 2016 Oct 14;291(42):22053-22062. doi: 10.1074/jbc.M116.749119. Epub 2016 Aug 23.