Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXU6PKO)

DOT Name Galanin receptor type 3 (GALR3)
Synonyms GAL3-R; GALR-3
Gene Name GALR3
Related Disease
Neoplasm ( )
Alcohol dependence ( )
Alcohol use disorder ( )
Anxiety ( )
Anxiety disorder ( )
Depression ( )
Major depressive disorder ( )
Psoriasis ( )
UniProt ID
GALR3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00001
Sequence
MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
GEAARGPE
Function Receptor for the hormone galanin. Receptor for the hormone spexin-1.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neoplasm DISZKGEW Definitive Biomarker [1]
Alcohol dependence DIS4ZSCO Strong Biomarker [2]
Alcohol use disorder DISMB65Y Strong Biomarker [2]
Anxiety DISIJDBA Strong Genetic Variation [3]
Anxiety disorder DISBI2BT Strong Genetic Variation [3]
Depression DIS3XJ69 Strong Genetic Variation [3]
Major depressive disorder DIS4CL3X Strong Biomarker [4]
Psoriasis DIS59VMN Strong Biomarker [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Galanin receptor type 3 (GALR3). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Galanin receptor type 3 (GALR3). [9]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of Galanin receptor type 3 (GALR3). [7]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Galanin receptor type 3 (GALR3). [8]
QUERCITRIN DM1DH96 Investigative QUERCITRIN increases the expression of Galanin receptor type 3 (GALR3). [10]
------------------------------------------------------------------------------------

References

1 Galanin and its three receptors in human pituitary adenoma.Neuropeptides. 2012 Oct;46(5):195-201. doi: 10.1016/j.npep.2012.07.003. Epub 2012 Aug 11.
2 Alcoholism is associated with GALR3 but not two other galanin receptor genes.Genes Brain Behav. 2007 Jul;6(5):473-81. doi: 10.1111/j.1601-183X.2006.00275.x. Epub 2006 Nov 3.
3 Brain galanin system genes interact with life stresses in depression-related phenotypes.Proc Natl Acad Sci U S A. 2014 Apr 22;111(16):E1666-73. doi: 10.1073/pnas.1403649111. Epub 2014 Mar 24.
4 Alterations in the neuropeptide galanin system in major depressive disorder involve levels of transcripts, methylation, and peptide.Proc Natl Acad Sci U S A. 2016 Dec 27;113(52):E8472-E8481. doi: 10.1073/pnas.1617824113. Epub 2016 Dec 9.
5 Lack of Galanin Receptor 3 Alleviates Psoriasis by Altering Vascularization, Immune Cell Infiltration, and CytokineExpression.J Invest Dermatol. 2018 Jan;138(1):199-207. doi: 10.1016/j.jid.2017.08.015. Epub 2017 Aug 24.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
8 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.