Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYLMZWW)

DOT Name DnaJ homolog subfamily C member 11 (DNAJC11)
Gene Name DNAJC11
Related Disease
Neuroblastoma ( )
Neuromuscular disease ( )
Neoplasm ( )
UniProt ID
DJC11_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00226 ; PF11875
Sequence
MATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFN
LVHQAYEVLSDPQTRAIYDIYGKRGLEMEGWEVVERRRTPAEIREEFERLQREREERRLQ
QRTNPKGTISVGVDATDLFDRYDEEYEDVSGSSFPQIEINKMHISQSIEAPLTATDTAIL
SGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDLQGPLFGLKLFRNLTPRCFVTTN
CALQFSSRGIRPGLTTVLARNLDKNTVGYLQWRWGIQSAMNTSIVRDTKTSHFTVALQLG
IPHSFALISYQHKFQDDDQTRVKGSLKAGFFGTVVEYGAERKISRHSVLGAAVSVGVPQG
VSLKVKLNRASQTYFFPIHLTDQLLPSAMFYATVGPLVVYFAMHRLIIKPYLRAQKEKEL
EKQRESAATDVLQKKQEAESAVRLMQESVRRIIEAEESRMGLIIVNAWYGKFVNDKSRKS
EKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNLKVLYQFRGVLHQVMV
LDSEALRIPKQSHRIDTDG
Function
[Isoform 1]: Required for mitochondrial inner membrane organization. Seems to function through its association with the MICOS complex and the mitochondrial outer membrane sorting assembly machinery (SAM) complex.
Reactome Pathway
Cristae formation (R-HSA-8949613 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neuroblastoma DISVZBI4 Definitive Genetic Variation [1]
Neuromuscular disease DISQTIJZ Strong Biomarker [2]
Neoplasm DISZKGEW Limited Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [8]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [9]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [13]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of DnaJ homolog subfamily C member 11 (DNAJC11). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of DnaJ homolog subfamily C member 11 (DNAJC11). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of DnaJ homolog subfamily C member 11 (DNAJC11). [12]
------------------------------------------------------------------------------------

References

1 Allelic variants of CAMTA1 and FLJ10737 within a commonly deleted region at 1p36 in neuroblastoma.Eur J Cancer. 2007 Feb;43(3):607-16. doi: 10.1016/j.ejca.2006.09.023. Epub 2007 Jan 11.
2 Mapping Interactome Networks of DNAJC11, a Novel Mitochondrial Protein Causing Neuromuscular Pathology in Mice.J Proteome Res. 2019 Nov 1;18(11):3896-3912. doi: 10.1021/acs.jproteome.9b00338. Epub 2019 Oct 7.
3 Identification and characterization of FLJ10737 and CAMTA1 genes on the commonly deleted region of neuroblastoma at human chromosome 1p36.31-p36.23.Int J Oncol. 2003 Oct;23(4):1219-24.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
13 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
14 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.