Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ9SGWB)

DOT Name Translin-associated protein X (TSNAX)
Synonyms Translin-associated factor X
Gene Name TSNAX
Related Disease
Autism spectrum disorder ( )
Bipolar disorder ( )
Depression ( )
Mental disorder ( )
Methamphetamine dependence ( )
Mood disorder ( )
Pervasive developmental disorder ( )
Advanced cancer ( )
Asperger syndrome ( )
Endometrial carcinoma ( )
Major depressive disorder ( )
UniProt ID
TSNAX_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3PJA; 3QB5
Pfam ID
PF01997
Sequence
MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLS
RDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAI
TTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRL
RVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVS
KKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS
Function Acts in combination with TSN as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC). Possible role in spermatogenesis.
Reactome Pathway
Small interfering RNA (siRNA) biogenesis (R-HSA-426486 )

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autism spectrum disorder DISXK8NV Strong Biomarker [1]
Bipolar disorder DISAM7J2 Strong Biomarker [2]
Depression DIS3XJ69 Strong Biomarker [3]
Mental disorder DIS3J5R8 Strong Biomarker [4]
Methamphetamine dependence DIS1UU1B Strong Biomarker [2]
Mood disorder DISLVMWO Strong Biomarker [3]
Pervasive developmental disorder DIS51975 Strong Biomarker [1]
Advanced cancer DISAT1Z9 moderate Altered Expression [5]
Asperger syndrome DIS7IBSP moderate Genetic Variation [6]
Endometrial carcinoma DISXR5CY moderate Biomarker [5]
Major depressive disorder DIS4CL3X moderate Genetic Variation [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Translin-associated protein X (TSNAX). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Translin-associated protein X (TSNAX). [9]
Aspirin DM672AH Approved Aspirin increases the expression of Translin-associated protein X (TSNAX). [10]
Sulindac DM2QHZU Approved Sulindac decreases the expression of Translin-associated protein X (TSNAX). [10]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Translin-associated protein X (TSNAX). [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Translin-associated protein X (TSNAX). [11]
------------------------------------------------------------------------------------

References

1 A 1q42 deletion involving DISC1, DISC2, and TSNAX in an autism spectrum disorder.Am J Med Genet A. 2009 Aug;149A(8):1758-62. doi: 10.1002/ajmg.a.32941.
2 Lack of association between translin-associated factor X gene (TSNAX) and methamphetamine dependence in the Japanese population.Prog Neuropsychopharmacol Biol Psychiatry. 2011 Aug 15;35(7):1618-22. doi: 10.1016/j.pnpbp.2011.06.001. Epub 2011 Jun 13.
3 Association of DISC1 and TSNAX genes and affective disorders in the depression case-control (DeCC) and bipolar affective case-control (BACCS) studies.Mol Psychiatry. 2010 Aug;15(8):844-9. doi: 10.1038/mp.2009.21. Epub 2009 Mar 3.
4 GSK3 negatively regulates TRAX, a scaffold protein implicated in mental disorders, for NHEJ-mediated DNA repair in neurons.Mol Psychiatry. 2018 Dec;23(12):2375-2390. doi: 10.1038/s41380-017-0007-z. Epub 2018 Jan 3.
5 Identification of chimeric TSNAX-DISC1 resulting from intergenic splicing in endometrial carcinoma through high-throughput RNA sequencing.Carcinogenesis. 2014 Dec;35(12):2687-97. doi: 10.1093/carcin/bgu201. Epub 2014 Sep 19.
6 Association of DISC1 with autism and Asperger syndrome.Mol Psychiatry. 2008 Feb;13(2):187-96. doi: 10.1038/sj.mp.4002031. Epub 2007 Jun 19.
7 DISC1-TSNAX and DAOA genes in major depression and citalopram efficacy.J Affect Disord. 2014 Oct;168:91-7. doi: 10.1016/j.jad.2014.06.048. Epub 2014 Jul 5.
8 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
11 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
12 Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.