Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTE2B1D)

• DTP Name: Organic anion transporting polypeptide 1A2 (SLCO1A2)
• Gene Name: SLCO1A2
• UniProt ID: P46721 (SO1A2_HUMAN)
• VARIDT ID: DTD0029
• Synonyms: OATP-A; OATP1A2; Organic anion-transporting polypeptide 1; SLC21A3; SLCO1A2; Sodium-independent organic anion transporter; Solute carrier family 21 member 3; Solute carrier organic anion transporter family member 1A2
• DTP Family: Organo Anion Transporter (OAT) Family
• Sequence:
  MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
  INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
  VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
  SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
  WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
  ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
  YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
  SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
  FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
  SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
  YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
  LKDDELKTKL
• Function: This Na(+)-independent transporter mediates the transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids. Selectively inhibited by the naringin.
• Endogenous Substrate(s): Cholate; Luciferin; Thyroid hormones; Dehydroepiandrosterone sulfate; Tauroursodeoxycholate; Thyroxine
• TCDB ID: 2.A.60.1.14
• Gene ID: 6579
• KEGG Pathway: Bile secretion (hsa04976)
• Reactome Pathway:
  Transport of organic anions (R-HSA-879518)
  Recycling of bile acids and salts (R-HSA-159418)

Molecular Interaction Atlas (MIA) of This DTP

40 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acebutolol	DM0TI4U	Hypertension	BA00-BA04	Approved	[3]
Acocantherin	DM7JT24	Atrial fibrillation	BC81.3	Approved	[4]
Atenolol	DMNKG1Z	Angina pectoris	BA40	Approved	[3]
Atorvastatin	DMF28YC	Acute coronary syndrome	BA41	Approved	[5]
Celiprolol hcl	DMD5LBX	Hypertension	BA00-BA04	Approved	[6]
Chlorambucil	DMRKE63	Chronic lymphocytic leukaemia	2A82.0	Approved	[7]
Cholic Acid	DM7OKQV	Cholelithiasis	DC11	Approved	[8]
Ciprofloxacin XR	DM2NLS9	Acute gonococcal cervicitis		Approved	[3]
Darunavir	DMN3GCH	Human immunodeficiency virus infection	1C62	Approved	[9]
Dehydroepiandrosterone sulfate	DM4Q80H	N. A.	N. A.	Approved	[10]
Dinoprostone	DMTYOPD	Medical abortion	JA00.1Z	Approved	[11]
Enalapril	DMNFUZR	Congestive heart failure	BD10	Approved	[12]
Enoxacin	DMYTE6L	Acute gonococcal cervicitis		Approved	[13]
Estrone sulfate	DMVBIZL	Atrophic vaginitis	GA30.2	Approved	[14]
Fexofenadine	DM17ONX	Allergic rhinitis	CA08.0	Approved	[5]
Gatifloxacin	DMSL679	Acute gonococcal cervicitis		Approved	[13]
Grepafloxacin	DMGLX0T	Chronic bronchitis	CA20.1	Approved	[13]
Hydroxyurea	DMOQVU9	Chronic myelogenous leukaemia	2A20.0	Approved	[15]
Imatinib	DM7RJXL	Acute lymphoblastic leukaemia	2A85	Approved	[16]
Labetalol	DMK8U72	Hypertension	BA00-BA04	Approved	[6]
Levofloxacin	DMS60RB	Acute maxillary sinusitis		Approved	[13]
Levothyroxine	DMHN027	Congenital hypothyroidism		Approved	[17]
lifitegrast	DM4WVC5	Dry eye disease	9E1Z	Approved	[18]
Liothyronine	DM6IR3P	Congenital hypothyroidism		Approved	[17]
Lomefloxacin	DMVRH9C	Bacterial infection	1A00-1C4Z	Approved	[13]
Methotrexate	DM2TEOL	Anterior urethra cancer		Approved	[19]
Montelukast	DMD157S	Allergic asthma	CA23.0	Approved	[20]
Nadolol	DMW6GVL	Angina pectoris	BA40	Approved	[6]
Norfloxacin	DMIZ6W2	Acute gonococcal cervicitis		Approved	[13]
Pitavastatin	DMJH792	Hypercholesterolaemia	5C80.0	Approved	[21]
PITAVASTATIN CALCIUM	DM1UJO0	Dyslipidemia	5C80-5C81	Approved	[21]
Probenecid	DMMFWOJ	Acute gonococcal cervicitis		Approved	[22]
Quinolones	DM5GVHU	Bacterial infection	1A00-1C4Z	Approved	[23]
Rocuronium	DMY9BMK	Muscle spasm	MB47.3	Approved	[24]
Rosuvastatin	DMMIQ7G	Arteriosclerosis	BD40	Approved	[25]
Saquinavir	DMG814N	Human immunodeficiency virus infection	1C62	Approved	[26]
Sotalol	DML60TN	Sinus rhythm disorder	BC9Y	Approved	[6]
Telmisartan	DMS3GX2	Hypertension	BA00-BA04	Approved	[27]
Trospium chloride	DM32XZT	Discovery agent	N.A.	Approved	[28]
Urea	DMUK75B	Dermatological disease	DA24.Y	Approved	[15]

4 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Atrasentan	DMM74PK	Diabetic nephropathy	GB61.Z	Phase 3	[29]
BQ-123	DM0MO8I	Pulmonary arterial hypertension	BB01.0	Phase 2	[30]
Sodium taurocholate	DM3GO0J	Type-2 diabetes	5A11	Phase 1/2	[8]
Taurocholic Acid	DM2LZ8F	Type-2 diabetes	5A11	Phase 1/2	[31]

2 Discontinued Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Rhodamine-123	DMQAK6T	Prostate cancer	2C82.0	Discontinued in Phase 1	[32]
TR-14035	DMWD39E	Multiple sclerosis	8A40	Discontinued in Phase 1	[33]

6 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AMINOHIPPURIC ACID	DMUN54G	Discovery agent	N.A.	Investigative	[34]
bromsulphthalein	DM9W2ZV	N. A.	N. A.	Investigative	[30]
glycocholic acid	DM0SXNM	Discovery agent	N.A.	Investigative	[30]
talinolol	DMRTD16	Discovery agent	N.A.	Investigative	[35]
tauroursodeoxycholic acid	DMFKRQE	Discovery agent	N.A.	Investigative	[8]
[3H]estradiol-17beta-glucuronide	DM3KJ45	Discovery agent	N.A.	Investigative	[36]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	3.82E-01	-4.79E-02	-4.04E-01
Adrenocortical carcinoma	2D11.Z	Kidney	1.90E-01	4.00E-03	3.05E-02
Alopecia	ED70	Skin from scalp	7.00E-01	4.05E-03	2.76E-02
Alzheimer's disease	8A20	Entorhinal cortex	1.16E-03	4.00E-01	4.43E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	7.59E-03	7.56E-02	1.02E+00
Aortic stenosis	BB70	Calcified aortic valve	8.45E-01	-1.19E-01	-2.64E-01
Apnea	7A40	Hyperplastic tonsil	3.25E-01	-3.64E-02	-2.38E-01
Arthropathy	FA00-FA5Z	Peripheral blood	7.84E-01	1.52E-02	1.03E-01
Asthma	CA23	Nasal and bronchial airway	1.86E-01	4.99E-02	2.27E-01
Atopic dermatitis	EA80	Skin	2.38E-02	2.12E-02	2.75E-01
Autism	6A02	Whole blood	5.84E-01	2.40E-02	1.87E-01
Autoimmune uveitis	9A96	Peripheral monocyte	8.55E-02	-2.82E-01	-1.86E+00
Autosomal dominant monocytopenia	4B04	Whole blood	3.94E-01	-6.87E-02	-4.34E-01
Bacterial infection of gingival	1C1H	Gingival tissue	1.76E-05	-1.16E-01	-7.97E-01
Batten disease	5C56.1	Whole blood	8.86E-01	2.57E-02	2.40E-01
Behcet's disease	4A62	Peripheral blood	3.51E-01	-1.12E-01	-6.56E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	4.84E-01	-1.61E-01	-3.33E-01
Bladder cancer	2C94	Bladder tissue	4.19E-05	5.37E-01	2.62E+00
Breast cancer	2C60-2C6Z	Breast tissue	2.07E-13	-1.60E-01	-4.88E-01
Cardioembolic stroke	8B11.20	Whole blood	6.34E-02	1.71E-03	1.16E-02
Cervical cancer	2C77	Cervical tissue	1.65E-01	-9.94E-02	-4.20E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	5.69E-01	-1.06E-03	-9.22E-03
Chronic hepatitis C	1E51.1	Whole blood	7.58E-01	-5.28E-02	-4.34E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	1.26E-02	1.81E-01	6.48E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	8.14E-02	2.55E-02	2.32E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	5.18E-02	1.85E-01	1.58E+00
Colon cancer	2B90	Colon tissue	4.20E-07	7.64E-02	4.58E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	2.03E-01	-9.03E-02	-5.75E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	5.59E-01	-6.74E-02	-4.94E-01
Endometriosis	GA10	Endometrium tissue	8.02E-01	-5.82E-03	-3.88E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	7.57E-01	-6.86E-03	-8.86E-02
Familial hypercholesterolemia	5C80.00	Whole blood	7.28E-02	-7.13E-02	-4.55E-01
Gastric cancer	2B72	Gastric tissue	6.05E-01	2.36E-02	2.97E-01
Glioblastopma	2A00.00	Nervous tissue	1.22E-59	-1.60E+00	-1.34E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	1.07E-03	-2.02E+00	-2.15E+00
Head and neck cancer	2D42	Head and neck tissue	9.28E-06	8.37E-02	5.83E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	4.59E-01	-4.42E-02	-4.52E-02
Huntington's disease	8A01.10	Whole blood	8.36E-01	-3.24E-04	-4.23E-03
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	3.17E-02	-5.48E-01	-1.17E+00
Immunodeficiency	4A00-4A20	Peripheral blood	2.94E-01	9.64E-02	7.97E-01
Influenza	1.00E+30	Whole blood	9.67E-01	-6.12E-02	-1.22E+00
Interstitial cystitis	GC00.3	Bladder tissue	5.02E-01	2.34E-02	2.40E-01
Intracranial aneurysm	8B01.0	Intracranial artery	1.73E-01	9.50E-02	7.02E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	7.76E-02	1.43E-03	6.26E-03
Ischemic stroke	8B11	Peripheral blood	5.59E-01	6.95E-02	4.41E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	2.46E-01	-2.60E-03	-1.33E-02
Lateral sclerosis	8B60.4	Cervical spinal cord	7.70E-01	-5.44E-02	-3.74E-01
Lateral sclerosis	8B60.4	Skin	2.02E-03	1.73E-01	3.82E+00
Liver cancer	2C12.0	Liver tissue	2.52E-03	-3.00E-01	-3.78E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.74E-02	-3.25E-01	-7.79E-01
Lung cancer	2C25	Lung tissue	1.86E-09	-2.50E-01	-3.86E-01
Lupus erythematosus	4A40	Whole blood	1.39E-02	6.78E-02	2.57E-01
Major depressive disorder	6A70-6A7Z	Whole blood	8.09E-01	-1.18E-02	-5.33E-02
Major depressive disorder	6A70-6A7Z	Hippocampus	2.28E-01	-5.92E-02	-1.22E-01
Melanoma	2C30	Skin	2.10E-01	-4.12E-02	-1.05E-01
Multiple myeloma	2A83.1	Bone marrow	9.37E-02	-1.90E-01	-6.98E-01
Multiple myeloma	2A83.1	Peripheral blood	6.07E-01	5.50E-02	2.67E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	6.43E-01	-3.17E-02	-2.27E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	8.00E-01	-2.86E-02	-4.04E-01
Myelofibrosis	2A20.2	Whole blood	5.76E-02	1.01E-01	1.29E+00
Myocardial infarction	BA41-BA50	Peripheral blood	7.49E-02	5.63E-02	1.72E-01
Myopathy	8C70.6	Muscle tissue	6.55E-01	-8.19E-03	-4.47E-02
Neonatal sepsis	KA60	Whole blood	2.06E-03	2.86E-02	2.08E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	4.18E-06	-2.05E+00	-2.89E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	8.69E-01	3.93E-02	2.28E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	1.85E-01	6.28E-02	1.06E+00
Olive pollen allergy	CA08.00	Peripheral blood	7.92E-01	5.66E-03	8.90E-02
Oral cancer	2B6E	Oral tissue	3.41E-05	1.48E-01	7.10E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	4.60E-01	2.15E-01	7.27E-01
Osteoporosis	FB83.1	Bone marrow	4.36E-01	0.00E+00	0.00E+00
Ovarian cancer	2C73	Ovarian tissue	5.65E-02	9.41E-02	3.67E-01
Pancreatic cancer	2C10	Pancreas	2.63E-02	-2.27E-01	-1.21E+00
Parkinson's disease	8A00.0	Substantia nigra tissue	7.98E-01	1.52E-01	2.97E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	4.90E-01	4.15E-02	3.96E-01
Pituitary cancer	2D12	Pituitary tissue	8.22E-01	1.07E-01	3.81E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	4.05E-01	2.14E-01	9.65E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	7.51E-01	2.64E-02	6.76E-02
Polycythemia vera	2A20.4	Whole blood	3.87E-02	-3.62E-02	-4.69E-01
Pompe disease	5C51.3	Biceps muscle	2.75E-01	-2.60E-02	-1.74E-01
Preterm birth	KA21.4Z	Myometrium	5.69E-01	-2.39E-02	-2.71E-01
Prostate cancer	2C82	Prostate	5.20E-01	-2.26E-01	-4.65E-01
Psoriasis	EA90	Skin	1.64E-08	-1.52E-01	-6.39E-01
Rectal cancer	2B92	Rectal colon tissue	9.26E-01	-1.81E-02	-1.60E-01
Renal cancer	2C90-2C91	Kidney	8.27E-01	-9.15E-03	-5.71E-02
Retinoblastoma	2D02.2	Uvea	8.01E-02	3.62E-02	3.59E-01
Rheumatoid arthritis	FA20	Synovial tissue	3.16E-01	-4.81E-02	-9.88E-02
Rhinovirus infection	CA42.1	Nasal epithelium tissue	7.96E-01	-2.50E-02	-2.27E-01
Schizophrenia	6A20	Prefrontal cortex	8.06E-03	-3.73E-01	-3.66E-01
Schizophrenia	6A20	Superior temporal cortex	4.39E-02	-3.53E-01	-8.32E-01
Scleroderma	4A42.Z	Whole blood	2.42E-01	6.91E-02	6.73E-01
Seizure	8A60-8A6Z	Whole blood	3.98E-03	-1.87E-01	-1.12E+00
Sensitive skin	EK0Z	Skin	1.77E-01	-9.37E-02	-7.48E-01
Sepsis with septic shock	1G41	Whole blood	1.96E-01	-1.01E-02	-6.68E-02
Shwachman-Diamond syndrome	3A70.0	Bone marrow	9.91E-01	7.05E-02	2.61E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	4.48E-02	6.88E-02	8.70E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	9.21E-01	6.32E-03	9.14E-02
Sjogren's syndrome	4A43.2	Salivary gland tissue	1.34E-01	2.63E-01	1.76E+00
Skin cancer	2C30-2C3Z	Skin	6.87E-09	1.27E-01	5.27E-01
Thrombocythemia	3B63	Whole blood	3.46E-01	-5.13E-03	-7.12E-02
Thrombocytopenia	3B64	Whole blood	6.56E-01	0.00E+00	0.00E+00
Thyroid cancer	2D10	Thyroid	1.81E-01	1.26E-02	7.92E-02
Tibial muscular dystrophy	8C75	Muscle tissue	3.29E-04	-1.24E-01	-1.07E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	6.54E-01	-8.49E-01	-1.56E+00
Type 2 diabetes	5A11	Liver tissue	1.39E-01	-6.13E-01	-6.63E-01
Ureter cancer	2C92	Urothelium	7.14E-01	1.30E-01	4.14E-01
Uterine cancer	2C78	Endometrium tissue	1.10E-03	-8.72E-04	-4.94E-03
Vitiligo	ED63.0	Skin	7.34E-02	6.06E-02	1.17E+00

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Acocantherin	Approved	Oocytes-OATP1A2	Km = 5500.0 microM	[37]
Fexofenadine	Approved	Human cervical cancer cell line (Hela)-OATP1A2	Km = 6.4 microM	[38]
Levofloxacin	Approved	Oocytes-OATP1A2	Km = 136.0 microM	[13]
Levothyroxine	Approved	Oocytes-OATP1A2	Km = 8.0 microM	[17]
Liothyronine	Approved	Oocytes-OATP1A2	Km = 6.5 microM	[17]
Methotrexate	Approved	Oocytes-OATP1A2	Km = 457.0 microM	[19]
PITAVASTATIN CALCIUM	Approved	Oocytes-OATP1A2	Km = 3.4 microM	[21]
Rosuvastatin	Approved	Human cervical cancer cell line (Hela)-OATP1A2	Km = 2.6 microM	[25]
Saquinavir	Approved	Oocytes-OATP1A2	Km = 36.4 microM	[26]
Trospium chloride	Approved	Primary human bladder urothelium cells (HBU)	Km = 34.9 microM	[28]

Clinical Trial Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Sodium taurocholate	Phase 1/2	Oocytes-OATP1A2	Km = 60.0 microM	[8]
Taurocholic Acid	Phase 1/2	Human embryonic kidney cells (HEK293)-OATP1A2	Km = 15.9 microM	[31]
Taurocholic Acid	Phase 1/2	Human liver cancer cells (HepG2)-OATP1A2	Km = 64.0 microM	[39]
Taurocholic Acid	Phase 1/2	Oocytes-OATP1A2	Km = 60.0 microM	[8]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
bromsulphthalein	Investigative	Oocytes-OATP1A2	Km = 20.0 microM	[8]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Sodium-independent organic anion transporter (SLCO1A2) DTT Info
• DTP DTT Type: Literature-reported

2 Investigative Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
naringin	DM4DG1Y	Discovery agent	N.A.	Investigative	[1]
[3H]estrone-3-sulphate	DMGPF0N	Discovery agent	N.A.	Investigative	[2]

References

• [1] Naringin is a major and selective clinical inhibitor of organic anion-transporting polypeptide 1A2 (OATP1A2) in grapefruit juice. Clin Pharmacol Ther. 2007 Apr;81(4):495-502.
• [2] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1219).
• [3] Fruit juice inhibition of uptake transport: a new type of food-drug interaction. Br J Clin Pharmacol. 2010 Nov;70(5):645-55.
• [4] Molecular cloning and functional characterization of the mouse organic-anion-transporting polypeptide 1 (Oatp1) and mapping of the gene to chromosome X. Biochem J. 2000 Jan 1;345 Pt 1:115-20.
• [5] Influence of the flavonoids apigenin, kaempferol, and quercetin on the function of organic anion transporting polypeptides 1A2 and 2B1. Biochem Pharmacol. 2010 Dec 1;80(11):1746-53.
• [6] Involvement of influx and efflux transport systems in gastrointestinal absorption of celiprolol. J Pharm Sci. 2009 Jul;98(7):2529-39.
• [7] Transporters and renal drug elimination. Annu Rev Pharmacol Toxicol. 2004;44:137-66.
• [8] Molecular and functional characterization of an organic anion transporting polypeptide cloned from human liver. Gastroenterology. 1995 Oct;109(4):1274-82.
• [9] P-glycoprotein mediates efflux transport of darunavir in human intestinal Caco-2 and ABCB1 gene-transfected renal LLC-PK1 cell lines. Biol Pharm Bull. 2009 Sep;32(9):1588-93.
• [10] Membrane transporters in drug development. Nat Rev Drug Discov. 2010 Mar;9(3):215-36.
• [11] Localization of organic anion transporting polypeptide 4 (Oatp4) in rat liver and comparison of its substrate specificity with Oatp1, Oatp2 and Oatp3. Pflugers Arch. 2001 Nov;443(2):188-95.
• [12] Uptake of enalapril and expression of organic anion transporting polypeptide 1 in zonal, isolated rat hepatocytes. Drug Metab Dispos. 2000 Jul;28(7):801-6.
• [13] Identification of influx transporter for the quinolone antibacterial agent levofloxacin. Mol Pharm. 2007 Jan-Feb;4(1):85-94.
• [14] Determination of OATP-, NTCP- and OCT-mediated substrate uptake activities in individual and pooled batches of cryopreserved human hepatocytes. Eur J Pharm Sci. 2011 Jul 17;43(4):297-307.
• [15] Transcellular movement of hydroxyurea is mediated by specific solute carrier transporters. Exp Hematol. 2011 Apr;39(4):446-56.
• [16] Environmental and genetic factors affecting transport of imatinib by OATP1A2. Clin Pharmacol Ther. 2011 Jun;89(6):816-20.
• [17] Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner. Endocrinology. 2001 May;142(5):2005-12.
• [18] Clinical Pharmacology and Biopharmaceutics review(s)
• [19] Interaction of methotrexate with organic-anion transporting polypeptide 1A2 and its genetic variants. J Pharmacol Exp Ther. 2006 Aug;318(2):521-9.
• [20] Effect of citrus juice and SLCO2B1 genotype on the pharmacokinetics of montelukast. J Clin Pharmacol. 2011 May;51(5):751-60.
• [21] Transporter-mediated influx and efflux mechanisms of pitavastatin, a new inhibitor of HMG-CoA reductase. J Pharm Pharmacol. 2005 Oct;57(10):1305-11.
• [22] Characterization of the efflux transport of 17beta-estradiol-D-17beta-glucuronide from the brain across the blood-brain barrier. J Pharmacol Exp Ther. 2001 Jul;298(1):316-22.
• [23] The Transporter Classification Database (TCDB): recent advances. Nucleic Acids Res. 2016 Jan 4;44(D1):D372-9. (ID: 2.A.60.1.14)
• [24] Polyspecific organic anion transporting polypeptides mediate hepatic uptake of amphipathic type II organic cations. J Pharmacol Exp Ther. 1999 Oct;291(1):147-52.
• [25] Drug and bile acid transporters in rosuvastatin hepatic uptake: function, expression, and pharmacogenetics. Gastroenterology. 2006 May;130(6):1793-806.
• [26] Human organic anion-transporting polypeptide OATP-A (SLC21A3) acts in concert with P-glycoprotein and multidrug resistance protein 2 in the vectorial transport of Saquinavir in Hep G2 cells. Mol Pharm. 2004 Jan 12;1(1):49-56.
• [27] Predominant contribution of OATP1B3 to the hepatic uptake of telmisartan, an angiotensin II receptor antagonist, in humans. Drug Metab Dispos. 2006 Jul;34(7):1109-15.
• [28] Expression of drug transporters and drug metabolizing enzymes in the bladder urothelium in man and affinity of the bladder spasmolytic trospium chloride to transporters likely involved in its pharmacokinetics. Mol Pharm. 2015 Jan 5;12(1):171-8.
• [29] Organic anion transporting polypeptide 1B1 activity classified by SLCO1B1 genotype influences atrasentan pharmacokinetics. Clin Pharmacol Ther. 2006 Mar;79(3):186-96.
• [30] Organic anion-transporting polypeptide B (OATP-B) and its functional comparison with three other OATPs of human liver. Gastroenterology. 2001 Feb;120(2):525-33.
• [31] Identification of multiple binding sites for substrate transport in bovine organic anion transporting polypeptide 1a2. Drug Metab Dispos. 2013 Mar;41(3):602-7.
• [32] Characterization of rhodamine-123 as a tracer dye for use in in vitro drug transport assays. PLoS One. 2012;7(3):e33253.
• [33] Characterization of hepatobiliary transport systems of a novel alpha4beta1/alpha4beta7 dual antagonist, TR-14035. Pharm Res. 2006 Nov;23(11):2646-56.
• [34] Characterization and identification of steroid sulfate transporters of human placenta. Am J Physiol Endocrinol Metab. 2003 Feb;284(2):E390-8.
• [35] Concentration-dependent effect of naringin on intestinal absorption of beta(1)-adrenoceptor antagonist talinolol mediated by p-glycoprotein and organic anion transporting polypeptide (Oatp). Pharm Res. 2009 Mar;26(3):560-7.
• [36] Regulation of renal oatp mRNA expression by testosterone. Am J Physiol. 1996 Feb;270(2 Pt 2):F332-7.
• [37] Multispecific amphipathic substrate transport by an organic anion transporter of human liver. J Hepatol. 1996 Nov;25(5):733-8.
• [38] OATP and P-glycoprotein transporters mediate the cellular uptake and excretion of fexofenadine. Drug Metab Dispos. 1999 Aug;27(8):866-71.
• [39] Molecular and functional characterization of bile acid transport in human hepatoblastoma HepG2 cells. Hepatology. 1996 May;23(5):1053-60.