Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT34BHT)

• DTT Name: Adrenergic receptor alpha-1D (ADRA1D)
• Synonyms: Alpha-adrenergic receptor 1a; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor; Alpha-1D adrenergic receptor; Alpha adrenergic receptor 1a; Alpha 1D-adrenoreceptor; Alpha 1D-adrenoceptor; ADRA1A
• Gene Name: ADRA1D
• DTT Type: Successful target; [1]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: ADA1D_HUMAN
• TTD ID: T53381
• Sequence:
  MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
  SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
  VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
  TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
  PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
  EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
  WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
  CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
  QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
  AVSLGVPHEVAEGATCQAYELADYSNLRETDI
• Function: This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  cGMP-PKG signaling pathway (hsa04022)
  Neuroactive ligand-receptor interaction (hsa04080)
  Adrenergic signaling in cardiomyocytes (hsa04261)
  Vascular smooth muscle contraction (hsa04270)
  Salivary secretion (hsa04970)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  G alpha (12/13) signalling events (R-HSA-416482)
  Adrenoceptors (R-HSA-390696)

Molecular Interaction Atlas (MIA) of This DTT

7 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alfuzosin	DMZVMKF	Benign prostatic hyperplasia	GA90	Approved	[1]
Armodafinil	DMGB035	Malignant glioma	2A00.0	Approved	[2]
Bunazosin	DM4I8O7	Glaucoma/ocular hypertension	9C61	Approved	[3]
Doxazosin	DM9PLRH	Benign prostatic hyperplasia	GA90	Approved	[4]
Moxisylyte	DMFCLYW	Erectile dysfunction	HA01.1	Approved	[5]
Terazosin	DM3JCVS	Benign prostatic hyperplasia	GA90	Approved	[6]
Trimazosin	DM1QLST	Congestive heart failure	BD10	Approved	[7]

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MEDETOMIDINE	DMX9Y7V	Pain	MG30-MG3Z	Phase 2	[8]
DL-017	DMM8GZT	Hypertension	BA00-BA04	Phase 1	[9]

2 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID30124346-Compound-LDT66	DMJMTNL	Benign prostatic hyperplasia	GA90	Patented	[10]
PMID30124346-Compound-LDT8	DM5MUNG	Benign prostatic hyperplasia	GA90	Patented	[10]

28 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
INDORAMIN	DMNSJFD	Hypertension	BA00-BA04	Withdrawn from market	[11]
Sunepitron	DM6M8ZX	N. A.	N. A.	Discontinued in Phase 3	[12]
TIOSPIRONE	DME5QDP	N. A.	N. A.	Discontinued in Phase 3	[13]
Dabuzalgron	DMDQH5E	Urinary incontinence	MF50.2	Discontinued in Phase 2	[14]
Deriglidole	DMYJ28R	Diabetic complication	5A2Y	Discontinued in Phase 2	[15]
FCE-22716	DMT2Z1L	Hypertension	BA00-BA04	Discontinued in Phase 2	[16]
FIDUXOSIN HYDROCHLORIDE	DMJRF5G	Prostate disease	GA91	Discontinued in Phase 2	[17]
GYKI-16084	DMMZQVS	Prostate disease	GA91	Discontinued in Phase 2	[18]
JTH-601	DMQRKH4	Prostate disease	GA91	Discontinued in Phase 2	[19]
MAZAPERTINE	DMRHYAU	N. A.	N. A.	Discontinued in Phase 2	[20]
NS-49	DMQ8P4U	Urinary incontinence	MF50.2	Discontinued in Phase 2	[21]
OPC-28326	DMYM8OG	Peripheral vascular disease	BD4Z	Discontinued in Phase 2	[22]
REC-15-2739	DMX4ZWK	Prostate disease	GA91	Discontinued in Phase 2	[23]
SL-25.1039	DME1JYP	Urinary incontinence	MF50.2	Discontinued in Phase 2	[24]
SL-89.0591	DMOXUEP	Prostate disease	GA91	Discontinued in Phase 2	[25]
SOU-001	DMPAEK5	Urinary incontinence	MF50.2	Discontinued in Phase 2	[26]
SUN-9221	DM6BO7R	Hypertension	BA00-BA04	Discontinued in Phase 1	[27]
ABANOQUIL	DMDOQCV	N. A.	N. A.	Terminated	[11]
AGN-193080	DMVS6BN	N. A.	N. A.	Terminated	[28]
BMY-7378	DMRHCEG	N. A.	N. A.	Terminated	[29]
CR-2991	DM51XDU	Hypertension	BA00-BA04	Terminated	[30]
NIGULDIPINE	DMSPWMF	N. A.	N. A.	Terminated	[31]
Siramesine	DMB6T7K	N. A.	N. A.	Terminated	[32]
SK&F-104078	DMRADBU	N. A.	N. A.	Terminated	[31]
SK&F-104856	DMN91EK	N. A.	N. A.	Terminated	[31]
SL-91.0893	DMJ9RLX	Prostate hyperplasia	GA90	Terminated	[33]
SNAP-5089	DMROJEN	Heart arrhythmia	BC65	Terminated	[31]
WB-4101	DMQU8B1	N. A.	N. A.	Terminated	[11]

48 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-nantenine	DM0L3GE	Discovery agent	N.A.	Investigative	[34]
(2,6-Dichloro-phenyl)-(1H-imidazol-2-yl)-amine	DM27TH9	Discovery agent	N.A.	Investigative	[35]
(2-Bromo-phenyl)-(1H-imidazol-2-yl)-amine	DM8N79M	Discovery agent	N.A.	Investigative	[35]
1',2',3',6'-Tetrahydro-[2,4']bipyridinyl	DMFDK4N	Discovery agent	N.A.	Investigative	[36]
1-(2-Chloro-phenyl)-piperazine	DM5RE71	Discovery agent	N.A.	Investigative	[37]
1-(2-Methoxy-phenyl)-piperazine	DM3M4RA	Discovery agent	N.A.	Investigative	[37]
1-(3-Fluoro-pyridin-2-yl)-4-methyl-piperazine	DMWFU3T	Discovery agent	N.A.	Investigative	[36]
1-(pyridin-2-yl)piperazine	DMKE7FG	Discovery agent	N.A.	Investigative	[36]
2-Pyridin-4-yl-1,2,3,4-tetrahydro-isoquinoline	DM5D09Q	Discovery agent	N.A.	Investigative	[38]
4-((E)-1-Naphthalen-1-yl-propenyl)-1H-imidazole	DMDOJ4E	Discovery agent	N.A.	Investigative	[39]
4-((Z)-1-Naphthalen-1-yl-propenyl)-1H-imidazole	DM1UK3G	Discovery agent	N.A.	Investigative	[39]
4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole	DMFYBLH	Discovery agent	N.A.	Investigative	[8]
4-(1-Naphthalen-1-yl-propyl)-1H-imidazole	DM64THP	Discovery agent	N.A.	Investigative	[39]
4-(1-Naphthalen-1-yl-vinyl)-1H-imidazole	DM49PR1	Discovery agent	N.A.	Investigative	[39]
4-(2,3-Dihydro-1H-phenalen-1-yl)-1H-imidazole	DMVIQ7F	Discovery agent	N.A.	Investigative	[39]
4-(3,4-Dihydro-1H-isoquinolin-2-yl)-quinoline	DMCOJIL	Discovery agent	N.A.	Investigative	[38]
4-(3-Hydroxy-piperidin-3-yl)-benzene-1,2-diol	DMUQWJZ	Discovery agent	N.A.	Investigative	[40]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[41]
4-(4-chlorobenzyl)-2-allylphthalazin-1(2H)-one	DMRBEZD	Discovery agent	N.A.	Investigative	[42]
4-(4-chlorobenzyl)-2-methylphthalazin-1(2H)-one	DMNYQGV	Discovery agent	N.A.	Investigative	[42]
4-(4-chlorobenzyl)phthalazin-1(2H)-one	DM9AEF0	Discovery agent	N.A.	Investigative	[42]
4-(4-Isopropyl-morpholin-2-yl)-benzene-1,2-diol	DMC9Z45	Discovery agent	N.A.	Investigative	[40]
4-(4-Methyl-indan-1-yl)-1H-imidazole	DMYZHXR	Discovery agent	N.A.	Investigative	[43]
4-Benzo[b]thiophen-4-yl-1H-imidazole	DM02Q8N	Discovery agent	N.A.	Investigative	[44]
4-benzyl-2-methylphthalazin-1(2H)-one	DM8MVU4	Discovery agent	N.A.	Investigative	[42]
4-Morpholin-2-yl-benzene-1,2-diol	DM049QO	Discovery agent	N.A.	Investigative	[40]
5-Bromo-8-piperazin-1-yl-imidazo[1,2-a]pyrazine	DMSVCJM	Discovery agent	N.A.	Investigative	[45]
6-hydroxy-3-(3',5'-dihydroxyphenyl)coumarin	DM4F5OG	Discovery agent	N.A.	Investigative	[46]
8-Piperazin-1-yl-imidazo[1,2-a]pyrazine	DM958EN	Discovery agent	N.A.	Investigative	[45]
AGN-192172	DM946RA	Discovery agent	N.A.	Investigative	[28]
Beta-methoxyamphetamine	DMA9CSG	Discovery agent	N.A.	Investigative	[47]
CORYNANTHEINE	DM18CUZ	Discovery agent	N.A.	Investigative	[31]
FLUANISONE	DMQSDM7	Discovery agent	N.A.	Investigative	[48]
Imidazolidin-2-ylidene-o-tolyl-amine	DMTGRAF	Discovery agent	N.A.	Investigative	[28]
Imidazolidin-2-ylidene-quinoxalin-6-yl-amine	DMZ5ISH	Discovery agent	N.A.	Investigative	[28]
ISOCLOZAPINE	DM52CPU	Discovery agent	N.A.	Investigative	[49]
LEVONORDEFRIN	DMWDJ0H	Discovery agent	N.A.	Investigative	[39]
N-(5-Bromo-quinoxalin-6-yl)-guanidine	DMD5E8G	Discovery agent	N.A.	Investigative	[28]
OCTOCLOTHEPIN	DM0UADK	Discovery agent	N.A.	Investigative	[50]
RWJ-38063	DMPJTLM	Discovery agent	N.A.	Investigative	[51]
RWJ-68157	DMUK7LX	Discovery agent	N.A.	Investigative	[51]
RWJ-69736	DM2EOBM	Discovery agent	N.A.	Investigative	[51]
SK&F-105854	DMYRKEJ	Discovery agent	N.A.	Investigative	[31]
SK&F-106686	DMHETY7	Discovery agent	N.A.	Investigative	[31]
SK&F-86466	DM4RHEZ	Discovery agent	N.A.	Investigative	[31]
SNAP-8719	DMCHPMA	Discovery agent	N.A.	Investigative	[29]
UH-301	DM5NYWV	N. A.	N. A.	Investigative	[52]
[3H]RX821002	DM6IRN4	Discovery agent	N.A.	Investigative	[53]

References

• [1] Alfuzosin: a review of the therapeutic use of the prolonged-release formulation given once daily in the management of benign prostatic hyperplasia. Drugs. 2002;62(4):633-53.
• [2] Mechanisms of modafinil: A review of current research. Neuropsychiatr Dis Treat. 2007 June; 3(3): 349-364.
• [3] Bunazosin, a selective alpha1-adrenoceptor antagonist, as an anti-glaucoma drug: effects on ocular circulation and retinal neuronal damage. Cardiovasc Drug Rev. 2005 Spring;23(1):43-56.
• [4] The role of combination medical therapy in benign prostatic hyperplasia. Int J Impot Res. 2008 Dec;20 Suppl 3:S33-43.
• [5] Pharmacokinetics of moxisylyte in healthy volunteers after intracavernous injection of increasing doses. Eur J Clin Pharmacol. 1996;49(5):411-5.
• [6] Induction of prostate apoptosis by alpha1-adrenoceptor antagonists: mechanistic significance of the quinazoline component. Prostate Cancer Prostatic Dis. 2002;5(2):88-95.
• [7] The hypotensive effect of trimazosin is not caused solely by alpha 1-adrenoceptor blockade. J Cardiovasc Pharmacol. 1984 Jan-Feb;6(1):142-50.
• [8] A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic recep... J Med Chem. 1994 Jul 22;37(15):2328-33.
• [9] Antihypertensive action and blockade of alpha1-adrenoceptors by DL-017, a quinazoline derivative. J Cardiovasc Pharmacol. 2001 Dec;38(6):893-9.
• [10] 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689.
• [11] Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. J Med Chem. 1995 Sep 1;38(18):3415-44.
• [12] An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment o... J Med Chem. 2006 Jun 1;49(11):3116-35.
• [13] 3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. J Med Chem. 1996 Jan 5;39(1):143-8.
• [14] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3469).
• [15] Mechanisms of the hypoglycemic effects of the alpha2-adrenoceptor antagonists SL84.0418 and deriglidole. Life Sci. 1998;62(9):839-52.
• [16] Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92.
• [17] Effect of fiduxosin, an antagonist selective for alpha(1A)- and alpha(1D)-adrenoceptors, on intraurethral and arterial pressure responses in conscious dogs. J Pharmacol Exp Ther. 2002 Feb;300(2):487-94.
• [18] A novel approach to the treatment of benign prostatic hyperplasia. BJU Int. 2006 Jun;97(6):1252-5.
• [19] Effect of JTH-601, a novel alpha(1)-adrenoceptor antagonist, on prostate function in dogs. Eur J Pharmacol. 2000 Apr 7;394(1):123-30.
• [20] A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2.
• [21] Pharmacokinetics of NS-49, a phenethylamine class alpha 1A-adrenoceptor agonist. 3rd communication: metabolism in rats, rabbits, dogs and monkeys, and effects on hepatic drug-metabolizing enzyme activities in rats after repeated administration. Arzneimittelforschung. 1999 Jul;49(7):612-7.
• [22] Mechanisms of action of OPC-28326, a selective hindlimb vasodilator. J Pharmacol Exp Ther. 1999 Nov;291(2):604-11.
• [23] Functional antagonistic activity of Rec 15/2739, a novel alpha-1 antagonist selective for the lower urinary tract, on noradrenaline-induced contraction of human prostate and mesenteric artery. J Pharmacol Exp Ther. 1996 Jun;277(3):1237-46.
• [24] Pharmaceutical co analysis sanofi aventis, 2006, Page(216).
• [25] Effects of alpha1-adrenoceptor antagonists on agonist and tilt-induced changes in blood pressure: relationships to uroselectivity. Eur J Pharmacol. 1999 May 28;373(1):51-62.
• [26] Drug repositioning: identifying and developing new uses for existing drugs. Nat Rev Drug Discov. 2004 Aug;3(8):673-83.
• [27] Synthesis and pharmacological evaluation of pyrroloazepine derivatives as potent antihypertensive agents with antiplatelet aggregation activity. Chem Pharm Bull (Tokyo). 1999 Feb;47(2):246-56.
• [28] Analogs of UK 14,304: Structural features responsible for alpha2 adrenoceptor activity, Bioorg. Med. Chem. Lett. 5(15):1745-1750 (1995).
• [29] Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione ... J Med Chem. 2005 Apr 21;48(8):3076-9.
• [30] WO patent application no. 2006,1244,90, Heterocycles as nicotinic acid receptor agonists for the treatment of dyslipidemia.
• [31] Alpha- and beta-adrenoceptors: from the gene to the clinic. 2. Structure-activity relationships and therapeutic applications. J Med Chem. 1995 Sep 15;38(19):3681-716.
• [32] Sigma ligands with subnanomolar affinity and preference for the sigma 2 binding site. 1. 3-(omega-aminoalkyl)-1H-indoles. J Med Chem. 1995 May 26;38(11):1998-2008.
• [33] Tissue Selectivity of in vivo alpha1-Adrenoceptor Biding of KMD-3213 in Rats. Eur Urol 1999;36(suppl 1):113-117.
• [34] Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
• [35] Synthesis and evaluation of 2-(arylamino)imidazoles as alpha 2-adrenergic agonists. J Med Chem. 1997 Jan 3;40(1):18-23.
• [36] Adrenoceptor and tetrabenazine antagonism activities of some pyridinyltetrahydropyridines. J Med Chem. 1984 Sep;27(9):1182-5.
• [37] Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. J Med Chem. 1991 Jun;34(6):1850-4.
• [38] 4-(3,4-dihydro-1H-isoquinolin-2yl)-pyridines and 4-(3,4-dihydro-1H-isoquinolin-2-yl)-quinolines as potent NR1/2B subtype selective NMDA receptor an... Bioorg Med Chem Lett. 2003 May 19;13(10):1759-62.
• [39] Medetomidine analogs as alpha 2-adrenergic ligands. 2. Design, synthesis, and biological activity of conformationally restricted naphthalene deriva... J Med Chem. 1996 Jul 19;39(15):3001-13.
• [40] Conformational effects on the activity of drugs. 13. A revision of previously proposed models for the activation of alpha- and beta-adrenergic rece... J Med Chem. 1992 Mar 20;35(6):1009-18.
• [41] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [42] Vasorelaxant activity of phthalazinones and related compounds. Bioorg Med Chem Lett. 2006 May 15;16(10):2786-90.
• [43] Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potent... J Med Chem. 1997 Sep 12;40(19):3014-24.
• [44] alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a ... J Med Chem. 2000 Mar 9;43(5):765-8.
• [45] Synthesis and hypoglycemic activity of substituted 8-(1-piperazinyl)imidazo[1,2-a]pyrazines. J Med Chem. 1992 Oct 16;35(21):3845-57.
• [46] Design, synthesis, and vasorelaxant and platelet antiaggregatory activities of coumarin-resveratrol hybrids. Bioorg Med Chem Lett. 2006 Jan 15;16(2):257-61.
• [47] Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
• [48] 2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. J Med Chem. 1987 Nov;30(11):2099-104.
• [49] Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53.
• [50] Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adre... J Med Chem. 2010 Oct 14;53(19):7021-34.
• [51] Novel arylpiperazines as selective alpha1-adrenergic receptor antagonists. Bioorg Med Chem Lett. 2000 May 15;10(10):1093-6.
• [52] N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7.
• [53] Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. J Med Chem. 1986 Oct;29(10):2000-3.