Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTF8CQI)

DTT Name	Tumor necrosis factor (TNF)
Synonyms	Tumour necrosis factor alpha; Tumour necrosis factor; Tumor necrosis factor ligand superfamily member 2; TNFalpha; TNFSF2; TNFA; TNF-alpha; TNF-a; TNF alpha; Cachectin
Gene Name	TNF
DTT Type	Successful target	[1]
BioChemical Class	Cytokine: tumor necrosis factor
UniProt ID	TNFA_HUMAN
TTD ID	T20178
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Function	It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective. Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR.
KEGG Pathway	MAPK signaling pathway (hsa04010 ) Cytokine-cytokine receptor interaction (hsa04060 ) NF-kappa B signaling pathway (hsa04064 ) Sphingolipid signaling pathway (hsa04071 ) mTOR signaling pathway (hsa04150 ) Apoptosis (hsa04210 ) TGF-beta signaling pathway (hsa04350 ) Osteoclast differentiation (hsa04380 ) Antigen processing and presentation (hsa04612 ) Toll-like receptor signaling pathway (hsa04620 ) NOD-like receptor signaling pathway (hsa04621 ) RIG-I-like receptor signaling pathway (hsa04622 ) Hematopoietic cell lineage (hsa04640 ) Natural killer cell mediated cytotoxicity (hsa04650 ) T cell receptor signaling pathway (hsa04660 ) Fc epsilon RI signaling pathway (hsa04664 ) TNF signaling pathway (hsa04668 ) Adipocytokine signaling pathway (hsa04920 ) Type II diabetes mellitus (hsa04930 ) Non-alcoholic fatty liver disease (NAFLD) (hsa04932 ) Type I diabetes mellitus (hsa04940 ) Alzheimer's disease (hsa05010 ) Amyotrophic lateral sclerosis (ALS) (hsa05014 ) Pertussis (hsa05133 ) Legionellosis (hsa05134 ) Leishmaniasis (hsa05140 ) Chagas disease (American trypanosomiasis) (hsa05142 ) African trypanosomiasis (hsa05143 ) Malaria (hsa05144 ) Toxoplasmosis (hsa05145 ) Amoebiasis (hsa05146 ) Tuberculosis (hsa05152 ) Hepatitis C (hsa05160 ) Hepatitis B (hsa05161 ) Influenza A (hsa05164 ) HTLV-I infection (hsa05166 ) Herpes simplex infection (hsa05168 ) Proteoglycans in cancer (hsa05205 ) Asthma (hsa05310 ) Inflammatory bowel disease (IBD) (hsa05321 ) Systemic lupus erythematosus (hsa05322 ) Rheumatoid arthritis (hsa05323 ) Allograft rejection (hsa05330 ) Graft-versus-host disease (hsa05332 ) Hypertrophic cardiomyopathy (HCM) (hsa05410 ) Dilated cardiomyopathy (hsa05414 )
Reactome Pathway	TNFR1-induced proapoptotic signaling (R-HSA-5357786 ) Regulation of TNFR1 signaling (R-HSA-5357905 ) TNFR1-induced NFkappaB signaling pathway (R-HSA-5357956 ) TNFR1-mediated ceramide production (R-HSA-5626978 ) TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 ) TNF signaling (R-HSA-75893 ) Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

10 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Adalimumab	DMQMV1B	Crohn disease	DD70	Approved	[1]
Certolizumab	DM5CL9Z	Rheumatoid arthritis	FA20	Approved	[2]
Enbrel	DM7RNP3	Arthritis	FA20	Approved	[3]
Etanercept	DMCV109	Arthritis	FA20	Approved	[4]
Golimumab	DMHZV7X	Psoriatic arthritis	FA21	Approved	[5]
Infliximab	DMH7OIA	Crohn disease	DD70	Approved	[6]
Lenalidomide	DM6Q7U4	Adult T-cell leukemia/lymphoma		Approved	[7]
Nafamostat	DMU1XOD	Pancreatitis	DC31-DC34	Approved	[8]
Pentoxifylline	DMU3DNC	Alcoholic hepatitis	DB94.1	Approved	[9]
Thalidomide	DM70BU5	Adult T-cell leukemia/lymphoma		Approved	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 10 Approved Drug(s)

31 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABP 501	DM2J4YB	Rheumatoid arthritis	FA20	Phase 3	[11]
AVT02	DM4CWNN	Plaque psoriasis	EA90.0	Phase 3	[12]
CPL-7075	DM62E7C	Diffuse systemic sclerosis	4A42.1	Phase 3	[13]
Golnerminogene pradenovac	DMKWV4B	Esophageal cancer	2B70	Phase 3	[14]
PF-06410293	DM2GF14	Rheumatoid arthritis	FA20	Phase 3	[15]
PF-06438179	DMM4C95	Rheumatoid arthritis	FA20	Phase 3	[16]
ABBV-154	DMVWLET	Crohn disease	DD70	Phase 2	[17]
ABT-122	DM23UQ9	Psoriatic arthritis	FA21	Phase 2	[18]
AN0128	DMT3S10	Atopic dermatitis	EA80	Phase 2	[19]
AP-301-IH	DM3ICYL	Pneumonia	CA40	Phase 2	[20]
BAICALEIN	DM4C7E6	Influenza virus infection	1E30-1E32	Phase 2	[21]
DLX-105	DMDJUWG	Osteoarthritis	FA00-FA05	Phase 2	[22]
ESBA-105	DMYZWDC	Ocular disease	1F00.1Z	Phase 2	[23]
Ortataxel	DM1EK5D	Solid tumour/cancer	2A00-2F9Z	Phase 2	[24]
Pegsunercept	DMTDANB	Rheumatoid arthritis	FA20	Phase 2	[25]
RDP58	DM4CIKA	Diarrhea	ME05.1	Phase 2	[26]
TNF alpha kinoid	DM3AIF7	Autoimmune diabetes	5A10	Phase 2	[27]
COVA322	DM824EG	Psoriasis vulgaris	EA90	Phase 1/2a	[28]
ART621	DMI17NX	Psoriasis vulgaris	EA90	Phase 1/2	[29]
XTMAB-16	DMPSNSC	Sarcoidosis	4B20.5	Phase 1/2	[30]
ABBV-257	DMCZI8L	Rheumatoid arthritis	FA20	Phase 1	[31]
AST-005	DMCN7WI	Psoriasis vulgaris	EA90	Phase 1	[32]
AVX-470	DMAKD0I	Inflammatory bowel disease	DD72	Phase 1	[31]
CYT-609	DMJ83Z7	Solid tumour/cancer	2A00-2F9Z	Phase 1	[33]
IA-14069	DM15SXV	Rheumatoid arthritis	FA20	Phase 1	[34]
INB03	DMCQTLG	Solid tumour/cancer	2A00-2F9Z	Phase 1	[35]
PF-05230905	DM7OC9K	Rheumatoid arthritis	FA20	Phase 1	[36]
PMI-005	DMY9XWB	Osteoarthritis	FA00-FA05	Phase 1	[37]
SAR441566	DMG2YW2	Inflammation	1A00-CA43.1	Phase 1	[38]
SAR442970	DM3DHWE	Inflammation	1A00-CA43.1	Phase 1	[39]
SAR444419	DMQICTG	Inflammation	1A00-CA43.1	Phase 1	[39]
------------------------------------------------------------------------------------


⏷ Show the Full List of 31 Clinical Trial Drug(s)

10 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CDP571	DM4HGMX	Crohn disease	DD70	Discontinued in Phase 3	[40]
Segard	DMIHQZ8	Sepsis	1G40-1G41	Discontinued in Phase 3	[41]
Camobucol	DMS3ECJ	Rheumatoid arthritis	FA20	Discontinued in Phase 2	[42]
CRx-191	DMB9QSJ	Psoriatic disorder	EA90	Discontinued in Phase 2	[43]
AME-527	DMR8XEN	Rheumatoid arthritis	FA20	Discontinued in Phase 1/2	[44]
CYT-007-TNFQb	DMKFIBH	Allergic rhinitis	CA08.0	Discontinued in Phase 1/2	[45]
ALS-00T2-0501	DM2QMKJ	Psoriasis vulgaris	EA90	Discontinued in Phase 1	[46]
FR-133605	DMXWL0N	Arthritis	FA20	Terminated	[49]
MDL-201112	DMMG1K3	Colitis	1A40.Z	Terminated	[50]
TNFQb therapeutic vaccines	DMTNB6G	Crohn disease	DD70	Terminated	[45]
------------------------------------------------------------------------------------


⏷ Show the Full List of 10 Discontinued Drug(s)

2 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABX-0401	DMKUPW0	Inflammatory bowel disease	DD72	Preclinical	[47]
Celastrol	DMWQIJX	Motor neurone disease	8B60	Preclinical	[48]
------------------------------------------------------------------------------------

6 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-Propanol, Isopropanol	DML5O0H	Discovery agent	N.A.	Investigative	[51]
DOM-0215	DMXJOYH	Discovery agent	N.A.	Investigative	[52]
IK-862	DMJA4UE	Discovery agent	N.A.	Investigative	[53]
PKF-241-466	DM04C9V	Discovery agent	N.A.	Investigative	[54]
PKF-242-484	DMNDLAS	Discovery agent	N.A.	Investigative	[54]
Y-39041	DMC95YB	Discovery agent	N.A.	Investigative	[55]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Osteoarthritis	FA20	Synovial tissue	4.93E-01	0.02	0.09
Rheumatoid arthritis	FA20	Synovial tissue	7.38E-01	-0.07	-0.16
Psoriasis	EA90	Skin	1.24E-17	0.42	1.18
Multiple myeloma	2C82	Bone marrow	1.66E-01	-0.14	-0.65
Neonatal sepsis	1G41	Whole blood	1.82E-05	0.16	0.42
Idiopathic pulmonary fibrosis	CA23	Lung tissue	8.64E-01	-0.06	-0.16
Lateral sclerosis	8A00.0	Cervical spinal cord	8.51E-01	0.05	0.27
------------------------------------------------------------------------------------


⏷ Show the Full List of DTT Expression Under 7 Diseases

References

1	Adalimumab for psoriasis patients who are non-responders to etanercept: open-label prospective evaluation. J Eur Acad Dermatol Venereol. 2009 Dec;23(12):1394-7.
2	Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
3	Oral pentoxifylline inhibits release of tumor necrosis factor-alpha from human peripheral blood monocytes : a potential treatment for aseptic loose... J Bone Joint Surg Am. 2001 Jul;83(7):1057-61.
4	The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72.
5	Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
6	Drug insight: tumor necrosis factor-converting enzyme as a pharmaceutical target for rheumatoid arthritis. Nat Clin Pract Rheumatol. 2008 Jun;4(6):300-9.
7	Thalidomide and thalidomide analogues for maintenance of remission in Crohn's disease. Cochrane Database Syst Rev. 2009 Apr 15;(2):CD007351.
8	Clinical pipeline report, company report or official report of AstraZeneca (2009).
9	Targeted therapies in myelodysplastic syndromes: ASH 2003 review. Semin Hematol. 2004 Apr;41(2 Suppl 4):13-20.
10	Efficacy of different thalidomide regimens for patients with multiple myeloma and its relationship with TNF-alpha level. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2008 Dec;16(6):1312-5.
11	Case study: biosimilar anti TNFalpha (Adalimumab) analysis of Fc effector functions. BMC Proc. 2013; 7(Suppl 6): P30.
12	AVT02: An Adalimumab Biosimilar. Clin Drug Investig. 2022 Oct;42(10):875-878.
13	Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
14	TNFerade, an adenovector carrying the transgene for human tumor necrosis factor alpha, for patients with advanced solid tumors: surgical experience... Ann Surg Oncol. 2005 Oct;12(10):825-30.
15	Apoptosis and the FLIP and NF-kappa B proteins as pharmacodynamic criteria for biosimilar TNF-alpha antagonists. Biologics. 2014 Jul 31;8:211-20.
16	Biosimilars in the therapy of inflammatory bowel diseases. Eur J Gastroenterol Hepatol. 2014 Jun;26(6):581-7.
17	Discovery of ABBV-154, an anti-TNF Glucocorticoid Receptor Modulator Immunology Antibody-Drug Conjugate (iADC). J Med Chem. 2023 Sep 14;66(17):12544-12558.
18	DOI: 10.1136/annrheumdis-2015-eular.4042
19	Inhibition of experimental periodontitis by a topical boron-based antimicrobial. J Dent Res. 2008 Feb;87(2):148-52.
20	AP301, a synthetic peptide mimicking the lectin-like domain of TNF, enhances amiloride-sensitive Na(+) current in primary dog, pig and rat alveolar type II cells. Pulm Pharmacol Ther. 2013 Jun;26(3):356-63.
21	Discovery of the inhibitors of tumor necrosis factor alpha with structure-based virtual screening. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6195-8.
22	Cyclic AMP inhibition of tumor necrosis factor alpha production induced by amyloidogenic C-terminal peptide of Alzheimer's amyloid precursor protein in macrophages: involvement of multiple intracellular pathways and cyclic AMP response element binding protein. Mol Pharmacol. 2003 Mar;63(3):690-8.
23	Pharmacokinetics and posterior segment biodistribution of ESBA105, an anti-TNF-alpha single-chain antibody, upon topical administration to the rabbit eye. Invest Ophthalmol Vis Sci. 2009 Feb;50(2):771-8.
24	New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
25	Diabetes-enhanced tumor necrosis factor-alpha production promotes apoptosis and the loss of retinal microvascular cells in type 1 and type 2 models of diabetic retinopathy. Am J Pathol. 2008 May;172(5):1411-8.
26	RDP58, a locally active TNF inhibitor, is effective in the dextran sulphate mouse model of chronic colitis. Inflamm Res. 2002 Nov;51(11):522-31.
27	Modulation of Anti-Tumor Necrosis Factor Alpha (TNF-alpha) Antibody Secretion in Mice Immunized with TNF-alpha Kinoid. Clin Vaccine Immunol. 2012 May; 19(5): 699-703.
28	Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801.
29	Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63.
30	Clinical pipeline report, company report or official report of Xentria
31	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
32	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
33	Phase I and Pharmacokinetic Studies of CYT-6091, a Novel PEGylated Colloidal Gold-rhTNF Nanomedicine. Clin Cancer Res. 2010 December 15; 16(24): 6139-6149.
34	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2023. Adis Insight
35	Clinical pipeline report, company report or official report of INmune Bio.
36	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033173)
37	US patent application no. 2008,0269,123, Methods for treating polycystic kidney disease (pkd) or other cyst forming diseases.
38	An orally available small molecule that targets soluble TNF to deliver anti-TNF biologic-like efficacy in rheumatoid arthritis. Front Pharmacol. 2022 Nov 16;13:1037983.
39	Clinical pipeline report, company report or official report of Sanofi
40	CDP571, a humanized monoclonal antibody to tumour necrosis factor-alpha, for steroid-dependent Crohn's disease: a randomized, double-blind, placebo... Aliment Pharmacol Ther. 2006 Mar 1;23(5):617-28.
41	Randomized, placebo-controlled trial of the anti-tumor necrosis factor antibody fragment afelimomab in hyperinflammatory response during severe sepsis: The RAMSES Study. Crit Care Med. 2001 Apr;29(4):765-9.
42	AGIX-4207 [2-[4-[[1-[[3,5-bis(1,1-dimethylethyl)-4-hydroxyphenyl]thio]-1-methylethyl]thio]-2,6-bis(1,1-dimethylethyl)phenoxy]acetic acid], a novel ... J Pharmacol Exp Ther. 2005 May;313(2):492-501.
43	CombinatoRx Drug Candidate CRx-191 Demonstrates Positive Phase 2 Results In Psoriasis. CombinatoRx. 2008.
44	IND Filed for AME-527, Monoclonal Antibody That Is a Potential Treatment for Rheumatoid Arthritis. P&T Community. 2015.
45	Therapeutic Vaccination with TNF-Kinoid in TNF Antagonist-Resistant Rheumatoid Arthritis: A Phase II Randomized, Controlled Clinical Trial. PLoS One. 2014; 9(12): e113465.
46	Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
47	US patent application no. 8007,790, Methods for treating polycystic kidney disease (pkd) or other cyst forming diseases.
48	Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52.
49	Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83.
50	Effect of the carbocyclic nucleoside analogue MDL 201,112 on inhibition of interferon-gamma-induced priming of Lewis (LEW/N) rat macrophages for enhanced respiratory burst and MHC class II Ia+ antigen expression. J Leukoc Biol. 1994 Aug;56(2):133-44.
51	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
52	The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954.
53	Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structu... J Med Chem. 2002 Nov 7;45(23):4954-7.
54	Beta-aryl-succinic acid hydroxamates as dual inhibitors of matrix metalloproteinases and tumor necrosis factor alpha converting enzyme. J Med Chem. 2002 May 23;45(11):2289-93.
55	A novel anti-rheumatic drug suppresses tumor necrosis factor-alpha and augments interleukin-10 in adjuvant arthritic rats. Eur J Pharmacol. 2000 Dec 15;409(3):331-5.