Details of the Drug

General Information of Drug (ID: DMCV109)

Drug Name
Etanercept
Synonyms Etanercept (sciatica); Etanercept (sciatica), BioAssets Development; Etanercept (sciatica), Cephalon
Indication
Disease Entry ICD 11 Status REF
Arthritis FA20 Approved [1]
Psoriatic arthritis FA21 Approved [2]
Sciatica ME84.3 Phase 3 [3]
Pemphigus vulgaris EB40 Phase 2 [4]
Drug Type
Monoclonal antibody
Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST
YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK
CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS
TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
ADMET Property
Absorption Cmax
The maximum plasma concentration (Cmax) of drug is 1.1 mcg/L [5]
Absorption Tmax
The time to maximum plasma concentration (Tmax) is 69 h [5]
Clearance
The clearance of drug is 160 mL/h [6]
Half-life
The concentration or amount of drug in body reduced by one-half in 102 hours [6]
Metabolism
The drug is metabolized via proteinases similarly to endogenous proteins []
Vd
The volume of distribution (Vd) of drug is 5.49 L [5]
Cross-matching ID
DrugBank ID
DB00005
TTD ID
D0I5QX
VARIDT ID
DR00437
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Tumor necrosis factor (TNF) TTF8CQI TNFA_HUMAN Modulator [7]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Arthritis
ICD Disease Classification FA20
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Tumor necrosis factor (TNF) DTT TNF 8.51E-01 0.05 0.27
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Etanercept
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Upadacitinib DM32B5U Major Additive immunosuppressive effects by the combination of Etanercept and Upadacitinib. Rheumatoid arthritis [FA20] [8]
Canakinumab DM8HLO5 Major Additive immunosuppressive effects by the combination of Etanercept and Canakinumab. Rheumatoid arthritis [FA20] [9]
Rilonacept DMGLUQS Major Additive immunosuppressive effects by the combination of Etanercept and Rilonacept. Rheumatoid arthritis [FA20] [9]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Etanercept and Golimumab. Rheumatoid arthritis [FA20] [10]
Dexamethasone DMMWZET Major Additive immunosuppressive effects by the combination of Etanercept and Dexamethasone. Rheumatoid arthritis [FA20] [10]
Adalimumab DMQMV1B Major Additive immunosuppressive effects by the combination of Etanercept and Adalimumab. Rheumatoid arthritis [FA20] [10]
Abatacept DMSA8RU Major Additive immunosuppressive effects by the combination of Etanercept and Abatacept. Rheumatoid arthritis [FA20] [11]
Anakinra DMU8KOD Major Additive immunosuppressive effects by the combination of Etanercept and Anakinra. Rheumatoid arthritis [FA20] [8]
⏷ Show the Full List of 8 DDI Information of This Drug
Coadministration of a Drug Treating the Disease Different from Etanercept (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Thioguanine DM7NKEV Major Additive immunosuppressive effects by the combination of Etanercept and Thioguanine. Acute myeloid leukaemia [2A60] [10]
Uracil mustard DMHL7OB Major Additive immunosuppressive effects by the combination of Etanercept and Uracil mustard. Acute myeloid leukaemia [2A60] [10]
Midostaurin DMI6E0R Major Additive immunosuppressive effects by the combination of Etanercept and Midostaurin. Acute myeloid leukaemia [2A60] [10]
Gemtuzumab ozogamicin DMJ2O7B Major Additive immunosuppressive effects by the combination of Etanercept and Gemtuzumab ozogamicin. Acute myeloid leukaemia [2A60] [10]
Idarubicin DMM0XGL Major Additive immunosuppressive effects by the combination of Etanercept and Idarubicin. Acute myeloid leukaemia [2A60] [10]
Daunorubicin DMQUSBT Major Additive immunosuppressive effects by the combination of Etanercept and Daunorubicin. Acute myeloid leukaemia [2A60] [10]
Oliceridine DM6MDCF Moderate Altered metabolism of Etanercept due to Oliceridine alters the formation of CYP450 enzymes. Acute pain [MG31] [8]
Siltuximab DMGEATB Major Additive immunosuppressive effects by the combination of Etanercept and Siltuximab. Anemia [3A00-3A9Z] [10]
Nifedipine DMSVOZT Moderate Altered metabolism of Etanercept due to Nifedipine alters the formation of CYP450 enzymes. Angina pectoris [BA40] [8]
Alprazolam DMC7XDN Moderate Altered metabolism of Etanercept due to Alprazolam alters the formation of CYP450 enzymes. Anxiety disorder [6B00-6B0Z] [8]
Methylphenobarbital DMDSWAG Moderate Altered metabolism of Etanercept due to Methylphenobarbital alters the formation of CYP450 enzymes. Anxiety disorder [6B00-6B0Z] [12]
Clobazam - Lundbeck DMW1OQ0 Moderate Altered metabolism of Etanercept due to Clobazam - Lundbeck alters the formation of CYP450 enzymes. Anxiety disorder [6B00-6B0Z] [8]
Budesonide DMJIBAW Major Additive immunosuppressive effects by the combination of Etanercept and Budesonide. Asthma [CA23] [10]
Aminophylline DML2NIB Moderate Altered metabolism of Etanercept due to Aminophylline alters the formation of CYP450 enzymes. Asthma [CA23] [8]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Etanercept and Roflumilast. Asthma [CA23] [8]
Dupilumab DMOAD2Y Major Additive immunosuppressive effects by the combination of Etanercept and Dupilumab. Atopic eczema [EA80] [10]
Linezolid DMGFPU2 Major Additive immunosuppressive effects by the combination of Etanercept and Linezolid. Bacterial infection [1A00-1C4Z] [10]
Temozolomide DMKECZD Major Additive immunosuppressive effects by the combination of Etanercept and Temozolomide. Brain cancer [2A00] [10]
Lomustine DMMWSUL Major Additive immunosuppressive effects by the combination of Etanercept and Lomustine. Brain cancer [2A00] [10]
Eribulin DM1DX4Q Major Additive immunosuppressive effects by the combination of Etanercept and Eribulin. Breast cancer [2C60-2C6Y] [10]
Talazoparib DM1KS78 Major Additive immunosuppressive effects by the combination of Etanercept and Talazoparib. Breast cancer [2C60-2C6Y] [10]
Ixabepilone DM2OZ3G Major Additive immunosuppressive effects by the combination of Etanercept and Ixabepilone. Breast cancer [2C60-2C6Y] [10]
LY2835219 DM93VBZ Major Additive immunosuppressive effects by the combination of Etanercept and LY2835219. Breast cancer [2C60-2C6Y] [10]
Pralatrexate DMAO80I Major Additive immunosuppressive effects by the combination of Etanercept and Pralatrexate. Breast cancer [2C60-2C6Y] [10]
Palbociclib DMD7L94 Major Additive immunosuppressive effects by the combination of Etanercept and Palbociclib. Breast cancer [2C60-2C6Y] [10]
Mitomycin DMH0ZJE Major Additive immunosuppressive effects by the combination of Etanercept and Mitomycin. Breast cancer [2C60-2C6Y] [10]
Thiotepa DMIZKOP Major Additive immunosuppressive effects by the combination of Etanercept and Thiotepa. Breast cancer [2C60-2C6Y] [10]
Cabazitaxel DMPAZHC Major Additive immunosuppressive effects by the combination of Etanercept and Cabazitaxel. Breast cancer [2C60-2C6Y] [10]
Bosutinib DMTI8YE Major Additive immunosuppressive effects by the combination of Etanercept and Bosutinib. Breast cancer [2C60-2C6Y] [10]
Trastuzumab DMZQOUX Major Additive immunosuppressive effects by the combination of Etanercept and Trastuzumab. Breast cancer [2C60-2C6Y] [10]
Atorvastatin DMF28YC Moderate Altered metabolism of Etanercept due to Atorvastatin alters the formation of CYP450 enzymes. Cardiovascular disease [BA00-BE2Z] [8]
Corticotropin DMP9TWZ Major Additive immunosuppressive effects by the combination of Etanercept and Corticotropin. Chronic kidney disease [GB61] [10]
Irinotecan DMP6SC2 Major Additive immunosuppressive effects by the combination of Etanercept and Irinotecan. Colorectal cancer [2B91] [10]
Oxaliplatin DMQNWRD Major Additive immunosuppressive effects by the combination of Etanercept and Oxaliplatin. Colorectal cancer [2B91] [10]
Aflibercept DMT3D5I Major Additive immunosuppressive effects by the combination of Etanercept and Aflibercept. Colorectal cancer [2B91] [10]
Capecitabine DMTS85L Major Additive immunosuppressive effects by the combination of Etanercept and Capecitabine. Colorectal cancer [2B91] [10]
Drospirenone DM1A9W3 Moderate Altered metabolism of Etanercept due to Drospirenone alters the formation of CYP450 enzymes. Contraceptive management [QA21] [8]
Levonorgestrel DM1DP7T Moderate Altered metabolism of Etanercept due to Levonorgestrel alters the formation of CYP450 enzymes. Contraceptive management [QA21] [8]
Etonogestrel DMKA8J4 Moderate Altered metabolism of Etanercept due to Etonogestrel alters the formation of CYP450 enzymes. Contraceptive management [QA21] [8]
Norgestimate DMYP4XC Moderate Altered metabolism of Etanercept due to Norgestimate alters the formation of CYP450 enzymes. Contraceptive management [QA21] [12]
Lidocaine DML4ZOT Moderate Altered metabolism of Etanercept due to Lidocaine alters the formation of CYP450 enzymes. Corneal disease [9A76-9A78] [8]
Nimodipine DMQ0RKZ Moderate Altered metabolism of Etanercept due to Nimodipine alters the formation of CYP450 enzymes. Coronary vasospastic disease [BA85] [8]
Oxtriphylline DMLHSE3 Moderate Altered metabolism of Etanercept due to Oxtriphylline alters the formation of CYP450 enzymes. Cough [MD12] [8]
Methadone DMTW6IU Moderate Altered metabolism of Etanercept due to Methadone alters the formation of CYP450 enzymes. Cough [MD12] [8]
Mycophenolic acid DMRBMAU Major Additive immunosuppressive effects by the combination of Etanercept and Mycophenolic acid. Crohn disease [DD70] [10]
Rivaroxaban DMQMBZ1 Moderate Altered metabolism of Etanercept due to Rivaroxaban alters the formation of CYP450 enzymes. Deep vein thrombosis [BD71] [8]
Polatuzumab vedotin DMF6Y0L Major Additive immunosuppressive effects by the combination of Etanercept and Polatuzumab vedotin. Diffuse large B-cell lymphoma [2A81] [10]
Lisocabtagene maraleucel DMP45ME Major Additive immunosuppressive effects by the combination of Etanercept and Lisocabtagene maraleucel. Diffuse large B-cell lymphoma [2A81] [10]
Axicabtagene ciloleucel DMYHN59 Major Additive immunosuppressive effects by the combination of Etanercept and Axicabtagene ciloleucel. Diffuse large B-cell lymphoma [2A81] [10]
PMID27977313-Compound-29 DMIF7KG Major Additive immunosuppressive effects by the combination of Etanercept and PMID27977313-Compound-29. Discovery agent [N.A.] [10]
PMID28870136-Compound-48 DMPIM9L Moderate Altered metabolism of Etanercept due to PMID28870136-Compound-48 alters the formation of CYP450 enzymes. Discovery agent [N.A.] [8]
Oestradiol valerate and dienogest DMZK0FQ Moderate Altered metabolism of Etanercept due to Oestradiol valerate and dienogest alters the formation of CYP450 enzymes. Endometriosis [GA10] [12]
Diazepam DM08E9O Moderate Altered metabolism of Etanercept due to Diazepam alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Primidone DM0WX6I Moderate Altered metabolism of Etanercept due to Primidone alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Mephenytoin DM5UGDK Moderate Altered metabolism of Etanercept due to Mephenytoin alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Ethosuximide DMDZ9LT Moderate Altered metabolism of Etanercept due to Ethosuximide alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Phenytoin DMNOKBV Moderate Altered metabolism of Etanercept due to Phenytoin alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Fosphenytoin DMOX3LB Moderate Altered metabolism of Etanercept due to Fosphenytoin alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Clonazepam DMTO13J Moderate Altered metabolism of Etanercept due to Clonazepam alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Phenobarbital DMXZOCG Moderate Altered metabolism of Etanercept due to Phenobarbital alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Carbamazepine DMZOLBI Moderate Altered metabolism of Etanercept due to Carbamazepine alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [8]
Nicardipine DMCDYW7 Moderate Altered metabolism of Etanercept due to Nicardipine alters the formation of CYP450 enzymes. Essential hypertension [BA00] [8]
Bay 80-6946 DMLOS5R Major Additive immunosuppressive effects by the combination of Etanercept and Bay 80-6946. Follicular lymphoma [2A80] [10]
Avapritinib DMK2GZX Major Additive immunosuppressive effects by the combination of Etanercept and Avapritinib. Gastrointestinal stromal tumour [2B5B] [10]
177Lu-DOTATATE DMT8GVU Major Additive immunosuppressive effects by the combination of Etanercept and 177Lu-DOTATATE. Hepatitis virus infection [1E50-1E51] [10]
Procarbazine DMIK367 Major Additive immunosuppressive effects by the combination of Etanercept and Procarbazine. Hodgkin lymphoma [2B30] [10]
Bleomycin DMNER5S Major Additive immunosuppressive effects by the combination of Etanercept and Bleomycin. Hodgkin lymphoma [2B30] [10]
Brentuximab vedotin DMWLC57 Major Additive immunosuppressive effects by the combination of Etanercept and Brentuximab vedotin. Hodgkin lymphoma [2B30] [10]
Simvastatin DM30SGU Moderate Altered metabolism of Etanercept due to Simvastatin alters the formation of CYP450 enzymes. Hyper-lipoproteinaemia [5C80] [8]
Lovastatin DM9OZWQ Moderate Altered metabolism of Etanercept due to Lovastatin alters the formation of CYP450 enzymes. Hyper-lipoproteinaemia [5C80] [8]
Nisoldipine DM7ISKJ Moderate Altered metabolism of Etanercept due to Nisoldipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [8]
Levamlodipine DM92S6N Moderate Altered metabolism of Etanercept due to Levamlodipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [8]
Isradipine DMA5XGH Moderate Altered metabolism of Etanercept due to Isradipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [8]
Amlodipine DMBDAZV Moderate Altered metabolism of Etanercept due to Amlodipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [8]
Felodipine DMOSW35 Moderate Altered metabolism of Etanercept due to Felodipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [8]
Fludrocortisone DMUDIR8 Major Additive immunosuppressive effects by the combination of Etanercept and Fludrocortisone. Hypo-osmolality/hyponatraemia [5C72] [10]
Triazolam DMETYK5 Moderate Altered metabolism of Etanercept due to Triazolam alters the formation of CYP450 enzymes. Insomnia [7A00-7A0Z] [8]
Olaratumab DMNYOIX Major Additive immunosuppressive effects by the combination of Etanercept and Olaratumab. Kaposi sarcoma [2B57] [10]
Methotrexate DM2TEOL Major Additive immunosuppressive effects by the combination of Etanercept and Methotrexate. Leukaemia [2A60-2B33] [10]
Nelarabine DMB6VEG Major Additive immunosuppressive effects by the combination of Etanercept and Nelarabine. Leukaemia [2A60-2B33] [10]
DTI-015 DMXZRW0 Major Additive immunosuppressive effects by the combination of Etanercept and DTI-015. Liver cancer [2C12] [10]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Etanercept and Denosumab. Low bone mass disorder [FB83] [13]
Brigatinib DM7W94S Major Additive immunosuppressive effects by the combination of Etanercept and Brigatinib. Lung cancer [2C25] [10]
Lurbinectedin DMEFRTZ Major Additive immunosuppressive effects by the combination of Etanercept and Lurbinectedin. Lung cancer [2C25] [10]
Osimertinib DMRJLAT Major Additive immunosuppressive effects by the combination of Etanercept and Osimertinib. Lung cancer [2C25] [10]
Belimumab DM3OBQF Major Additive immunosuppressive effects by the combination of Etanercept and Belimumab. Lupus erythematosus [4A40] [10]
Primaquine DMWQ16I Major Additive immunosuppressive effects by the combination of Etanercept and Primaquine. Malaria [1F40-1F45] [10]
Inotuzumab ozogamicin DMAC130 Major Additive immunosuppressive effects by the combination of Etanercept and Inotuzumab ozogamicin. Malignant haematopoietic neoplasm [2B33] [10]
Rituximab DM1YVZT Major Additive immunosuppressive effects by the combination of Etanercept and Rituximab. Malignant haematopoietic neoplasm [2B33] [10]
Tositumomab DMMYZ3D Major Additive immunosuppressive effects by the combination of Etanercept and Tositumomab. Malignant haematopoietic neoplasm [2B33] [10]
Fludarabine DMVRLT7 Major Additive immunosuppressive effects by the combination of Etanercept and Fludarabine. Malignant haematopoietic neoplasm [2B33] [10]
Pentostatin DM0HXDS Major Additive immunosuppressive effects by the combination of Etanercept and Pentostatin. Mature B-cell leukaemia [2A82] [10]
Ofatumumab DM295PR Major Additive immunosuppressive effects by the combination of Etanercept and Ofatumumab. Mature B-cell leukaemia [2A82] [10]
Obinutuzumab DM3BVAE Major Additive immunosuppressive effects by the combination of Etanercept and Obinutuzumab. Mature B-cell leukaemia [2A82] [10]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Etanercept and Cladribine. Mature B-cell leukaemia [2A82] [8]
Idelalisib DM602WT Major Additive immunosuppressive effects by the combination of Etanercept and Idelalisib. Mature B-cell leukaemia [2A82] [10]
GDC-0199 DMH0QKA Major Additive immunosuppressive effects by the combination of Etanercept and GDC-0199. Mature B-cell leukaemia [2A82] [10]
Chlorambucil DMRKE63 Major Additive immunosuppressive effects by the combination of Etanercept and Chlorambucil. Mature B-cell leukaemia [2A82] [10]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Etanercept and Alemtuzumab. Mature B-cell leukaemia [2A82] [14]
Acalabrutinib DM7GCVW Major Additive immunosuppressive effects by the combination of Etanercept and Acalabrutinib. Mature B-cell lymphoma [2A85] [10]
Clofarabine DMCVJ86 Major Additive immunosuppressive effects by the combination of Etanercept and Clofarabine. Mature B-cell lymphoma [2A85] [10]
Blinatumomab DMGECIJ Major Additive immunosuppressive effects by the combination of Etanercept and Blinatumomab. Mature B-cell lymphoma [2A85] [10]
Ibrutinib DMHZCPO Major Additive immunosuppressive effects by the combination of Etanercept and Ibrutinib. Mature B-cell lymphoma [2A85] [10]
Vincristine DMINOX3 Major Additive immunosuppressive effects by the combination of Etanercept and Vincristine. Mature B-cell lymphoma [2A85] [10]
Teniposide DMLW57T Major Additive immunosuppressive effects by the combination of Etanercept and Teniposide. Mature B-cell lymphoma [2A85] [10]
Tisagenlecleucel DMM9BJD Major Additive immunosuppressive effects by the combination of Etanercept and Tisagenlecleucel. Mature B-cell lymphoma [2A85] [10]
Mercaptopurine DMTM2IK Major Additive immunosuppressive effects by the combination of Etanercept and Mercaptopurine. Mature B-cell lymphoma [2A85] [10]
Ponatinib DMYGJQO Major Additive immunosuppressive effects by the combination of Etanercept and Ponatinib. Mature B-cell lymphoma [2A85] [10]
Cytarabine DMZD5QR Major Additive immunosuppressive effects by the combination of Etanercept and Cytarabine. Mature B-cell lymphoma [2A85] [10]
Mechlorethamine DM0CVXA Major Additive immunosuppressive effects by the combination of Etanercept and Mechlorethamine. Mature T-cell lymphoma [2A90] [10]
Dacarbazine DMNPZL4 Major Additive immunosuppressive effects by the combination of Etanercept and Dacarbazine. Melanoma [2C30] [10]
Ethinyl estradiol DMODJ40 Moderate Altered metabolism of Etanercept due to Ethinyl estradiol alters the formation of CYP450 enzymes. Menopausal disorder [GA30] [12]
Midazolam DMXOELT Moderate Altered metabolism of Etanercept due to Midazolam alters the formation of CYP450 enzymes. Mood/affect symptom [MB24] [8]
Carfilzomib DM48K0X Major Additive immunosuppressive effects by the combination of Etanercept and Carfilzomib. Multiple myeloma [2A83] [10]
Panobinostat DM58WKG Major Additive immunosuppressive effects by the combination of Etanercept and Panobinostat. Multiple myeloma [2A83] [10]
Lenalidomide DM6Q7U4 Major Additive immunosuppressive effects by the combination of Etanercept and Lenalidomide. Multiple myeloma [2A83] [10]
Thalidomide DM70BU5 Major Additive immunosuppressive effects by the combination of Etanercept and Thalidomide. Multiple myeloma [2A83] [10]
Selinexor DMBD4K3 Major Additive immunosuppressive effects by the combination of Etanercept and Selinexor. Multiple myeloma [2A83] [10]
Belantamab mafodotin DMBT3AI Major Additive immunosuppressive effects by the combination of Etanercept and Belantamab mafodotin. Multiple myeloma [2A83] [10]
Elotuzumab DMEYHG9 Major Additive immunosuppressive effects by the combination of Etanercept and Elotuzumab. Multiple myeloma [2A83] [10]
Daratumumab DMKCIUZ Major Additive immunosuppressive effects by the combination of Etanercept and Daratumumab. Multiple myeloma [2A83] [10]
Bortezomib DMNO38U Major Additive immunosuppressive effects by the combination of Etanercept and Bortezomib. Multiple myeloma [2A83] [10]
Melphalan DMOLNHF Major Additive immunosuppressive effects by the combination of Etanercept and Melphalan. Multiple myeloma [2A83] [10]
Tecfidera DM2OVDT Major Additive immunosuppressive effects by the combination of Etanercept and Tecfidera. Multiple sclerosis [8A40] [10]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Etanercept and Siponimod. Multiple sclerosis [8A40] [9]
Ocrelizumab DMEZ2KH Major Additive immunosuppressive effects by the combination of Etanercept and Ocrelizumab. Multiple sclerosis [8A40] [10]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Etanercept and Ozanimod. Multiple sclerosis [8A40] [8]
Deflazacort DMV0RNS Major Additive immunosuppressive effects by the combination of Etanercept and Deflazacort. Muscular dystrophy [8C70] [10]
Bexarotene DMOBIKY Major Additive immunosuppressive effects by the combination of Etanercept and Bexarotene. Mycosis fungoides [2B01] [10]
Romidepsin DMT5GNL Major Additive immunosuppressive effects by the combination of Etanercept and Romidepsin. Mycosis fungoides [2B01] [10]
Decitabine DMQL8XJ Major Additive immunosuppressive effects by the combination of Etanercept and Decitabine. Myelodysplastic syndrome [2A37] [10]
Azacitidine DMTA5OE Major Additive immunosuppressive effects by the combination of Etanercept and Azacitidine. Myelodysplastic syndrome [2A37] [10]
Nilotinib DM7HXWT Major Additive immunosuppressive effects by the combination of Etanercept and Nilotinib. Myeloproliferative neoplasm [2A20] [10]
Ruxolitinib DM7Q98D Major Additive immunosuppressive effects by the combination of Etanercept and Ruxolitinib. Myeloproliferative neoplasm [2A20] [10]
Imatinib DM7RJXL Major Additive immunosuppressive effects by the combination of Etanercept and Imatinib. Myeloproliferative neoplasm [2A20] [10]
Dasatinib DMJV2EK Major Additive immunosuppressive effects by the combination of Etanercept and Dasatinib. Myeloproliferative neoplasm [2A20] [10]
Hydroxyurea DMOQVU9 Major Additive immunosuppressive effects by the combination of Etanercept and Hydroxyurea. Myeloproliferative neoplasm [2A20] [10]
Omacetaxine mepesuccinate DMPU2WX Major Additive immunosuppressive effects by the combination of Etanercept and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [10]
Busulfan DMXYJ9C Major Additive immunosuppressive effects by the combination of Etanercept and Busulfan. Myeloproliferative neoplasm [2A20] [10]
Inebilizumab DMI0RHA Major Additive immunosuppressive effects by the combination of Etanercept and Inebilizumab. Nervous system paraneoplastic/autoimmune disorder [8E4A] [10]
Atezolizumab DMMF8U0 Major Additive immunosuppressive effects by the combination of Etanercept and Atezolizumab. Non-small cell lung cancer [2C25] [10]
Olaparib DM8QB1D Major Additive immunosuppressive effects by the combination of Etanercept and Olaparib. Ovarian cancer [2C73] [10]
Rucaparib DM9PVX8 Major Additive immunosuppressive effects by the combination of Etanercept and Rucaparib. Ovarian cancer [2C73] [10]
Carboplatin DMG281S Major Additive immunosuppressive effects by the combination of Etanercept and Carboplatin. Ovarian cancer [2C73] [10]
Altretamine DMKLAYG Major Additive immunosuppressive effects by the combination of Etanercept and Altretamine. Ovarian cancer [2C73] [10]
MK-4827 DMLYGH4 Major Additive immunosuppressive effects by the combination of Etanercept and MK-4827. Ovarian cancer [2C73] [10]
Topotecan DMP6G8T Major Additive immunosuppressive effects by the combination of Etanercept and Topotecan. Ovarian cancer [2C73] [10]
Buprenorphine DMPRI8G Moderate Altered metabolism of Etanercept due to Buprenorphine alters the formation of CYP450 enzymes. Pain [MG30-MG3Z] [8]
Hydrocodone DMQ2JO5 Moderate Altered metabolism of Etanercept due to Hydrocodone alters the formation of CYP450 enzymes. Pain [MG30-MG3Z] [8]
Oxycodone DMXLKHV Moderate Altered metabolism of Etanercept due to Oxycodone alters the formation of CYP450 enzymes. Pain [MG30-MG3Z] [8]
Streptozocin DMOF7AT Major Additive immunosuppressive effects by the combination of Etanercept and Streptozocin. Pancreatic cancer [2C10] [10]
Levamisole DM5EN79 Major Additive immunosuppressive effects by the combination of Etanercept and Levamisole. Parasitic infection [1D0Y-1G2Z] [10]
Pemetrexed DMMX2E6 Major Additive immunosuppressive effects by the combination of Etanercept and Pemetrexed. Pleural mesothelioma [2C26] [10]
Prednisone DM2HG4X Major Additive immunosuppressive effects by the combination of Etanercept and Prednisone. Postoperative inflammation [1A00-CA43] [10]
Hydrocortisone DMGEMB7 Major Additive immunosuppressive effects by the combination of Etanercept and Hydrocortisone. Postoperative inflammation [1A00-CA43] [10]
Brodalumab DMASDQ6 Major Additive immunosuppressive effects by the combination of Etanercept and Brodalumab. Psoriasis [EA90] [10]
Efalizumab DMCKL5V Moderate Additive immunosuppressive effects by the combination of Etanercept and Efalizumab. Psoriasis [EA90] [15]
Infliximab DMH7OIA Major Additive immunosuppressive effects by the combination of Etanercept and Infliximab. Psoriasis [EA90] [10]
Ustekinumab DMHTYK3 Major Additive immunosuppressive effects by the combination of Etanercept and Ustekinumab. Psoriasis [EA90] [10]
Tildrakizumab DMLW9HG Major Additive immunosuppressive effects by the combination of Etanercept and Tildrakizumab. Psoriasis [EA90] [10]
Risankizumab DMM32GT Major Additive immunosuppressive effects by the combination of Etanercept and Risankizumab. Psoriasis [EA90] [10]
Ixekizumab DMXW92T Major Additive immunosuppressive effects by the combination of Etanercept and Ixekizumab. Psoriasis [EA90] [10]
Aldesleukin DM4YMIS Major Additive immunosuppressive effects by the combination of Etanercept and Aldesleukin. Renal cell carcinoma [2C90] [10]
Everolimus DM8X2EH Major Additive immunosuppressive effects by the combination of Etanercept and Everolimus. Renal cell carcinoma [2C90] [10]
Temsirolimus DMS104F Major Additive immunosuppressive effects by the combination of Etanercept and Temsirolimus. Renal cell carcinoma [2C90] [10]
Fentanyl DM8WAHT Moderate Altered metabolism of Etanercept due to Fentanyl alters the formation of CYP450 enzymes. Sensation disturbance [MB40] [8]
Sufentanil DMU7YEL Moderate Altered metabolism of Etanercept due to Sufentanil alters the formation of CYP450 enzymes. Sensation disturbance [MB40] [8]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Etanercept when combined with Anthrax vaccine. Sepsis [1G40-1G41] [16]
Mogamulizumab DMISH0Z Major Additive immunosuppressive effects by the combination of Etanercept and Mogamulizumab. Sezary syndrome [2B02] [10]
Floxuridine DM04LR2 Major Additive immunosuppressive effects by the combination of Etanercept and Floxuridine. Solid tumour/cancer [2A00-2F9Z] [10]
Dactinomycin DM2YGNW Major Additive immunosuppressive effects by the combination of Etanercept and Dactinomycin. Solid tumour/cancer [2A00-2F9Z] [10]
Methylprednisolone DM4BDON Major Additive immunosuppressive effects by the combination of Etanercept and Methylprednisolone. Solid tumour/cancer [2A00-2F9Z] [10]
Cyclophosphamide DM4O2Z7 Major Additive immunosuppressive effects by the combination of Etanercept and Cyclophosphamide. Solid tumour/cancer [2A00-2F9Z] [10]
Vinblastine DM5TVS3 Major Additive immunosuppressive effects by the combination of Etanercept and Vinblastine. Solid tumour/cancer [2A00-2F9Z] [10]
PDX-101 DM6OC53 Major Additive immunosuppressive effects by the combination of Etanercept and PDX-101. Solid tumour/cancer [2A00-2F9Z] [10]
Ifosfamide DMCT3I8 Major Additive immunosuppressive effects by the combination of Etanercept and Ifosfamide. Solid tumour/cancer [2A00-2F9Z] [10]
Docetaxel DMDI269 Major Additive immunosuppressive effects by the combination of Etanercept and Docetaxel. Solid tumour/cancer [2A00-2F9Z] [10]
Trabectedin DMG3Y89 Major Additive immunosuppressive effects by the combination of Etanercept and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [10]
Mitoxantrone DMM39BF Major Additive immunosuppressive effects by the combination of Etanercept and Mitoxantrone. Solid tumour/cancer [2A00-2F9Z] [10]
LEE011 DMMX75K Major Additive immunosuppressive effects by the combination of Etanercept and LEE011. Solid tumour/cancer [2A00-2F9Z] [10]
Etoposide DMNH3PG Major Additive immunosuppressive effects by the combination of Etanercept and Etoposide. Solid tumour/cancer [2A00-2F9Z] [10]
Epirubicin DMPDW6T Major Additive immunosuppressive effects by the combination of Etanercept and Epirubicin. Solid tumour/cancer [2A00-2F9Z] [10]
Prednisolone DMQ8FR2 Major Additive immunosuppressive effects by the combination of Etanercept and Prednisolone. Solid tumour/cancer [2A00-2F9Z] [10]
Cisplatin DMRHGI9 Major Additive immunosuppressive effects by the combination of Etanercept and Cisplatin. Solid tumour/cancer [2A00-2F9Z] [10]
Gemcitabine DMSE3I7 Major Additive immunosuppressive effects by the combination of Etanercept and Gemcitabine. Solid tumour/cancer [2A00-2F9Z] [10]
Norethindrone DMTY169 Moderate Altered metabolism of Etanercept due to Norethindrone alters the formation of CYP450 enzymes. Solid tumour/cancer [2A00-2F9Z] [12]
Fluorouracil DMUM7HZ Major Additive immunosuppressive effects by the combination of Etanercept and Fluorouracil. Solid tumour/cancer [2A00-2F9Z] [10]
Taxol DMUOT9V Major Additive immunosuppressive effects by the combination of Etanercept and Taxol. Solid tumour/cancer [2A00-2F9Z] [10]
Doxorubicin DMVP5YE Major Additive immunosuppressive effects by the combination of Etanercept and Doxorubicin. Solid tumour/cancer [2A00-2F9Z] [10]
Vinorelbine DMVXFYE Major Additive immunosuppressive effects by the combination of Etanercept and Vinorelbine. Solid tumour/cancer [2A00-2F9Z] [10]
Warfarin DMJYCVW Moderate Altered metabolism of Etanercept due to Warfarin alters the formation of CYP450 enzymes. Supraventricular tachyarrhythmia [BC81] [8]
Pomalidomide DMTGBAX Major Additive immunosuppressive effects by the combination of Etanercept and Pomalidomide. Systemic sclerosis [4A42] [10]
Plicamycin DM7C8YV Major Additive immunosuppressive effects by the combination of Etanercept and Plicamycin. Testicular cancer [2C80] [10]
Apixaban DM89JLN Moderate Altered metabolism of Etanercept due to Apixaban alters the formation of CYP450 enzymes. Thrombosis [DB61-GB90] [8]
Dicumarol DMFQCB1 Moderate Altered metabolism of Etanercept due to Dicumarol alters the formation of CYP450 enzymes. Thrombosis [DB61-GB90] [12]
Trimetrexate DMDEA85 Major Additive immunosuppressive effects by the combination of Etanercept and Trimetrexate. Toxoplasmosis [1F57] [10]
Muromonab DM8ANCF Major Additive immunosuppressive effects by the combination of Etanercept and Muromonab. Transplant rejection [NE84] [10]
Sirolimus DMGW1ID Major Additive immunosuppressive effects by the combination of Etanercept and Sirolimus. Transplant rejection [NE84] [10]
Azathioprine DMMZSXQ Major Additive immunosuppressive effects by the combination of Etanercept and Azathioprine. Transplant rejection [NE84] [10]
Mycophenolate mofetil DMPQAGE Major Additive immunosuppressive effects by the combination of Etanercept and Mycophenolate mofetil. Transplant rejection [NE84] [10]
Basiliximab DMWNRZT Major Additive immunosuppressive effects by the combination of Etanercept and Basiliximab. Transplant rejection [NE84] [10]
Belatacept DMXLYQF Major Additive immunosuppressive effects by the combination of Etanercept and Belatacept. Transplant rejection [NE84] [10]
Durvalumab DM4PVDY Major Additive immunosuppressive effects by the combination of Etanercept and Durvalumab. Ureteral cancer [2C92] [10]
Triamcinolone DM98IXF Major Additive immunosuppressive effects by the combination of Etanercept and Triamcinolone. Vasomotor/allergic rhinitis [CA08] [10]
Disopyramide DM5SYZP Moderate Altered metabolism of Etanercept due to Disopyramide alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [8]
Mexiletine DMCTE9R Moderate Altered metabolism of Etanercept due to Mexiletine alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [8]
Procainamide DMNMXR8 Moderate Altered metabolism of Etanercept due to Procainamide alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [8]
Propafenone DMPIBJK Moderate Altered metabolism of Etanercept due to Propafenone alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [8]
Flecainide DMSQDLE Moderate Altered metabolism of Etanercept due to Flecainide alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [8]
Amiodarone DMUTEX3 Moderate Altered metabolism of Etanercept due to Amiodarone alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [8]
Ganciclovir DM1MBYQ Major Additive immunosuppressive effects by the combination of Etanercept and Ganciclovir. Virus infection [1A24-1D9Z] [10]
Trifluridine DMG2YBD Major Additive immunosuppressive effects by the combination of Etanercept and Trifluridine. Virus infection [1A24-1D9Z] [10]
Valganciclovir DMS2IUH Major Additive immunosuppressive effects by the combination of Etanercept and Valganciclovir. Virus infection [1A24-1D9Z] [10]
⏷ Show the Full List of 213 DDI Information of This Drug

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
2 Etanercept and Methotrexate as Monotherapy or in Combination for Psoriatic Arthritis: Primary Results From a Randomized, Controlled Phase III Trial. Arthritis Rheumatol. 2019 Jul;71(7):1112-1124.
3 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6789).
4 ClinicalTrials.gov (NCT00135720) Study of Etanercept (Enbrel) in the Treatment of Pemphigus Vulgaris
5 Zhou SY, Shu C, Korth-Bradley J, Raible D, Palmisano M, Wadjula J, Fatenejad S, Bjornsson T: Integrated population pharmacokinetics of etanercept in healthy subjects and in patients with rheumatoid arthritis and ankylosing spondylitis. J Clin Pharmacol. 2011 Jun;51(6):864-75. doi: 10.1177/0091270010375961. Epub 2010 Sep 17.
6 FDA Approved Drug Products: Enbrel (etanercept) injection solution
7 The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72.
8 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
9 Cerner Multum, Inc. "Australian Product Information.".
10 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
11 Product Information. Orencia (abatacept). Bristol-Myers Squibb, Princeton, NJ.
12 Product Information. Cosentyx (secukinumab). Novartis Pharmaceuticals, East Hanover, NJ.
13 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
14 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
15 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
16 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]