Details of the Drug

General Information of Drug (ID: DMQMV1B)

Drug Name
Adalimumab
Synonyms Humira; Adalimumab (genetical recombination); Humira (TN); Adalimumab (USAN/INN); Adalimumab (genetical recombination) (JAN)
Indication
Disease Entry ICD 11 Status REF
Crohn disease DD70 Approved [1]
Hidradenitis suppurativa ED92.0 Approved [2]
Mucositis CA00 Approved [3]
Psoriatic arthritis FA21 Approved [4]
Pyoderma gangrenosum EB21 Approved [5]
Rheumatoid arthritis FA20 Approved [6]
Sarcoidosis 4B20.5 Approved [7]
Ulcerative colitis DD71 Approved [8]
Coronavirus Disease 2019 (COVID-19) 1D6Y Investigative [9]
⏷ Show the Full List of Indication(s)
Therapeutic Class
Antirheumatic Agents
Drug Type
Antibody
Sequence
>light chain
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>heavy chain
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY
ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
ADMET Property
Absorption AUC
The area under the plot of plasma concentration (AUC) of drug is 363.6 mgday/L [10]
Absorption Tmax
The time to maximum plasma concentration (Tmax) is 8.88 h [10]
Clearance
The clearance of drug is 12 mL/h []
Half-life
The concentration or amount of drug in body reduced by one-half in 2 weeks []
Metabolism
The drug is metabolized via opsonization via the reticuloendothelial system [11]
Vd
The volume of distribution (Vd) of drug is 4.7-6.0 L []
Cross-matching ID
DrugBank ID
DB00051
TTD ID
D0K5KS
VARIDT ID
DR00441
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Tumor necrosis factor (TNF) TTF8CQI TNFA_HUMAN Not Available [12]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Crohn disease
ICD Disease Classification DD70
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Tumor necrosis factor (TNF) DTT TNF 1.24E-17 0.42 1.18
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Adalimumab
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Upadacitinib DM32B5U Major Additive immunosuppressive effects by the combination of Adalimumab and Upadacitinib. Rheumatoid arthritis [FA20] [13]
Canakinumab DM8HLO5 Major Additive immunosuppressive effects by the combination of Adalimumab and Canakinumab. Rheumatoid arthritis [FA20] [14]
Rilonacept DMGLUQS Major Additive immunosuppressive effects by the combination of Adalimumab and Rilonacept. Rheumatoid arthritis [FA20] [14]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Adalimumab and Golimumab. Rheumatoid arthritis [FA20] [15]
Dexamethasone DMMWZET Major Additive immunosuppressive effects by the combination of Adalimumab and Dexamethasone. Rheumatoid arthritis [FA20] [15]
Abatacept DMSA8RU Major Additive immunosuppressive effects by the combination of Adalimumab and Abatacept. Rheumatoid arthritis [FA20] [16]
⏷ Show the Full List of 6 DDI Information of This Drug
Coadministration of a Drug Treating the Disease Different from Adalimumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Thioguanine DM7NKEV Major Additive immunosuppressive effects by the combination of Adalimumab and Thioguanine. Acute myeloid leukaemia [2A60] [15]
Uracil mustard DMHL7OB Major Additive immunosuppressive effects by the combination of Adalimumab and Uracil mustard. Acute myeloid leukaemia [2A60] [15]
Midostaurin DMI6E0R Major Additive immunosuppressive effects by the combination of Adalimumab and Midostaurin. Acute myeloid leukaemia [2A60] [15]
Gemtuzumab ozogamicin DMJ2O7B Major Additive immunosuppressive effects by the combination of Adalimumab and Gemtuzumab ozogamicin. Acute myeloid leukaemia [2A60] [15]
Idarubicin DMM0XGL Major Additive immunosuppressive effects by the combination of Adalimumab and Idarubicin. Acute myeloid leukaemia [2A60] [15]
Daunorubicin DMQUSBT Major Additive immunosuppressive effects by the combination of Adalimumab and Daunorubicin. Acute myeloid leukaemia [2A60] [15]
Oliceridine DM6MDCF Moderate Altered metabolism of Adalimumab due to Oliceridine alters the formation of CYP450 enzymes. Acute pain [MG31] [13]
Siltuximab DMGEATB Major Additive immunosuppressive effects by the combination of Adalimumab and Siltuximab. Anemia [3A00-3A9Z] [15]
Nifedipine DMSVOZT Moderate Altered metabolism of Adalimumab due to Nifedipine alters the formation of CYP450 enzymes. Angina pectoris [BA40] [13]
Alprazolam DMC7XDN Moderate Altered metabolism of Adalimumab due to Alprazolam alters the formation of CYP450 enzymes. Anxiety disorder [6B00-6B0Z] [13]
Methylphenobarbital DMDSWAG Moderate Altered metabolism of Adalimumab due to Methylphenobarbital alters the formation of CYP450 enzymes. Anxiety disorder [6B00-6B0Z] [17]
Clobazam - Lundbeck DMW1OQ0 Moderate Altered metabolism of Adalimumab due to Clobazam - Lundbeck alters the formation of CYP450 enzymes. Anxiety disorder [6B00-6B0Z] [13]
Budesonide DMJIBAW Major Additive immunosuppressive effects by the combination of Adalimumab and Budesonide. Asthma [CA23] [15]
Aminophylline DML2NIB Moderate Altered metabolism of Adalimumab due to Aminophylline alters the formation of CYP450 enzymes. Asthma [CA23] [13]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Adalimumab and Roflumilast. Asthma [CA23] [13]
Dupilumab DMOAD2Y Major Additive immunosuppressive effects by the combination of Adalimumab and Dupilumab. Atopic eczema [EA80] [15]
Linezolid DMGFPU2 Major Additive immunosuppressive effects by the combination of Adalimumab and Linezolid. Bacterial infection [1A00-1C4Z] [15]
Temozolomide DMKECZD Major Additive immunosuppressive effects by the combination of Adalimumab and Temozolomide. Brain cancer [2A00] [15]
Lomustine DMMWSUL Major Additive immunosuppressive effects by the combination of Adalimumab and Lomustine. Brain cancer [2A00] [15]
Eribulin DM1DX4Q Major Additive immunosuppressive effects by the combination of Adalimumab and Eribulin. Breast cancer [2C60-2C6Y] [15]
Talazoparib DM1KS78 Major Additive immunosuppressive effects by the combination of Adalimumab and Talazoparib. Breast cancer [2C60-2C6Y] [15]
Ixabepilone DM2OZ3G Major Additive immunosuppressive effects by the combination of Adalimumab and Ixabepilone. Breast cancer [2C60-2C6Y] [15]
LY2835219 DM93VBZ Major Additive immunosuppressive effects by the combination of Adalimumab and LY2835219. Breast cancer [2C60-2C6Y] [15]
Pralatrexate DMAO80I Major Additive immunosuppressive effects by the combination of Adalimumab and Pralatrexate. Breast cancer [2C60-2C6Y] [15]
Palbociclib DMD7L94 Major Additive immunosuppressive effects by the combination of Adalimumab and Palbociclib. Breast cancer [2C60-2C6Y] [15]
Mitomycin DMH0ZJE Major Additive immunosuppressive effects by the combination of Adalimumab and Mitomycin. Breast cancer [2C60-2C6Y] [15]
Thiotepa DMIZKOP Major Additive immunosuppressive effects by the combination of Adalimumab and Thiotepa. Breast cancer [2C60-2C6Y] [15]
Cabazitaxel DMPAZHC Major Additive immunosuppressive effects by the combination of Adalimumab and Cabazitaxel. Breast cancer [2C60-2C6Y] [15]
Bosutinib DMTI8YE Major Additive immunosuppressive effects by the combination of Adalimumab and Bosutinib. Breast cancer [2C60-2C6Y] [15]
Trastuzumab DMZQOUX Major Additive immunosuppressive effects by the combination of Adalimumab and Trastuzumab. Breast cancer [2C60-2C6Y] [15]
Atorvastatin DMF28YC Moderate Altered metabolism of Adalimumab due to Atorvastatin alters the formation of CYP450 enzymes. Cardiovascular disease [BA00-BE2Z] [13]
Corticotropin DMP9TWZ Major Additive immunosuppressive effects by the combination of Adalimumab and Corticotropin. Chronic kidney disease [GB61] [15]
Irinotecan DMP6SC2 Major Additive immunosuppressive effects by the combination of Adalimumab and Irinotecan. Colorectal cancer [2B91] [15]
Oxaliplatin DMQNWRD Major Additive immunosuppressive effects by the combination of Adalimumab and Oxaliplatin. Colorectal cancer [2B91] [15]
Aflibercept DMT3D5I Major Additive immunosuppressive effects by the combination of Adalimumab and Aflibercept. Colorectal cancer [2B91] [15]
Capecitabine DMTS85L Major Additive immunosuppressive effects by the combination of Adalimumab and Capecitabine. Colorectal cancer [2B91] [15]
Drospirenone DM1A9W3 Moderate Altered metabolism of Adalimumab due to Drospirenone alters the formation of CYP450 enzymes. Contraceptive management [QA21] [13]
Levonorgestrel DM1DP7T Moderate Altered metabolism of Adalimumab due to Levonorgestrel alters the formation of CYP450 enzymes. Contraceptive management [QA21] [13]
Desogestrel DM27U4Y Moderate Altered metabolism of Adalimumab due to Desogestrel alters the formation of CYP450 enzymes. Contraceptive management [QA21] [17]
Mestranol DMG3F94 Moderate Altered metabolism of Adalimumab due to Mestranol alters the formation of CYP450 enzymes. Contraceptive management [QA21] [17]
Etonogestrel DMKA8J4 Moderate Altered metabolism of Adalimumab due to Etonogestrel alters the formation of CYP450 enzymes. Contraceptive management [QA21] [13]
Norgestimate DMYP4XC Moderate Altered metabolism of Adalimumab due to Norgestimate alters the formation of CYP450 enzymes. Contraceptive management [QA21] [17]
Lidocaine DML4ZOT Moderate Altered metabolism of Adalimumab due to Lidocaine alters the formation of CYP450 enzymes. Corneal disease [9A76-9A78] [13]
Nimodipine DMQ0RKZ Moderate Altered metabolism of Adalimumab due to Nimodipine alters the formation of CYP450 enzymes. Coronary vasospastic disease [BA85] [13]
Oxtriphylline DMLHSE3 Moderate Altered metabolism of Adalimumab due to Oxtriphylline alters the formation of CYP450 enzymes. Cough [MD12] [13]
Methadone DMTW6IU Moderate Altered metabolism of Adalimumab due to Methadone alters the formation of CYP450 enzymes. Cough [MD12] [13]
Mycophenolic acid DMRBMAU Major Additive immunosuppressive effects by the combination of Adalimumab and Mycophenolic acid. Crohn disease [DD70] [15]
Rivaroxaban DMQMBZ1 Moderate Altered metabolism of Adalimumab due to Rivaroxaban alters the formation of CYP450 enzymes. Deep vein thrombosis [BD71] [13]
Polatuzumab vedotin DMF6Y0L Major Additive immunosuppressive effects by the combination of Adalimumab and Polatuzumab vedotin. Diffuse large B-cell lymphoma [2A81] [15]
Axicabtagene ciloleucel DMYHN59 Major Additive immunosuppressive effects by the combination of Adalimumab and Axicabtagene ciloleucel. Diffuse large B-cell lymphoma [2A81] [15]
PMID27977313-Compound-29 DMIF7KG Major Additive immunosuppressive effects by the combination of Adalimumab and PMID27977313-Compound-29. Discovery agent [N.A.] [15]
PMID28870136-Compound-48 DMPIM9L Moderate Altered metabolism of Adalimumab due to PMID28870136-Compound-48 alters the formation of CYP450 enzymes. Discovery agent [N.A.] [13]
Oestradiol valerate and dienogest DMZK0FQ Moderate Altered metabolism of Adalimumab due to Oestradiol valerate and dienogest alters the formation of CYP450 enzymes. Endometriosis [GA10] [17]
Diazepam DM08E9O Moderate Altered metabolism of Adalimumab due to Diazepam alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Primidone DM0WX6I Moderate Altered metabolism of Adalimumab due to Primidone alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Mephenytoin DM5UGDK Moderate Altered metabolism of Adalimumab due to Mephenytoin alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Ethosuximide DMDZ9LT Moderate Altered metabolism of Adalimumab due to Ethosuximide alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Phenytoin DMNOKBV Moderate Altered metabolism of Adalimumab due to Phenytoin alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Fosphenytoin DMOX3LB Moderate Altered metabolism of Adalimumab due to Fosphenytoin alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Clonazepam DMTO13J Moderate Altered metabolism of Adalimumab due to Clonazepam alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Phenobarbital DMXZOCG Moderate Altered metabolism of Adalimumab due to Phenobarbital alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Carbamazepine DMZOLBI Moderate Altered metabolism of Adalimumab due to Carbamazepine alters the formation of CYP450 enzymes. Epilepsy/seizure [8A61-8A6Z] [13]
Nicardipine DMCDYW7 Moderate Altered metabolism of Adalimumab due to Nicardipine alters the formation of CYP450 enzymes. Essential hypertension [BA00] [13]
Bay 80-6946 DMLOS5R Major Additive immunosuppressive effects by the combination of Adalimumab and Bay 80-6946. Follicular lymphoma [2A80] [15]
Avapritinib DMK2GZX Major Additive immunosuppressive effects by the combination of Adalimumab and Avapritinib. Gastrointestinal stromal tumour [2B5B] [15]
177Lu-DOTATATE DMT8GVU Major Additive immunosuppressive effects by the combination of Adalimumab and 177Lu-DOTATATE. Hepatitis virus infection [1E50-1E51] [15]
Procarbazine DMIK367 Major Additive immunosuppressive effects by the combination of Adalimumab and Procarbazine. Hodgkin lymphoma [2B30] [15]
Bleomycin DMNER5S Major Additive immunosuppressive effects by the combination of Adalimumab and Bleomycin. Hodgkin lymphoma [2B30] [15]
Brentuximab vedotin DMWLC57 Major Additive immunosuppressive effects by the combination of Adalimumab and Brentuximab vedotin. Hodgkin lymphoma [2B30] [15]
Zidovudine DM4KI7O Major Additive immunosuppressive effects by the combination of Adalimumab and Zidovudine. Human immunodeficiency virus disease [1C60-1C62] [15]
Zalcitabine DMH7MUV Moderate Increased risk of peripheral neuropathy by the combination of Adalimumab and Zalcitabine. Human immunodeficiency virus disease [1C60-1C62] [18]
Simvastatin DM30SGU Moderate Altered metabolism of Adalimumab due to Simvastatin alters the formation of CYP450 enzymes. Hyper-lipoproteinaemia [5C80] [13]
Lovastatin DM9OZWQ Moderate Altered metabolism of Adalimumab due to Lovastatin alters the formation of CYP450 enzymes. Hyper-lipoproteinaemia [5C80] [13]
Nisoldipine DM7ISKJ Moderate Altered metabolism of Adalimumab due to Nisoldipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [13]
Levamlodipine DM92S6N Moderate Altered metabolism of Adalimumab due to Levamlodipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [13]
Isradipine DMA5XGH Moderate Altered metabolism of Adalimumab due to Isradipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [13]
Amlodipine DMBDAZV Moderate Altered metabolism of Adalimumab due to Amlodipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [13]
Felodipine DMOSW35 Moderate Altered metabolism of Adalimumab due to Felodipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [13]
Fludrocortisone DMUDIR8 Major Additive immunosuppressive effects by the combination of Adalimumab and Fludrocortisone. Hypo-osmolality/hyponatraemia [5C72] [15]
Triazolam DMETYK5 Moderate Altered metabolism of Adalimumab due to Triazolam alters the formation of CYP450 enzymes. Insomnia [7A00-7A0Z] [13]
Olaratumab DMNYOIX Major Additive immunosuppressive effects by the combination of Adalimumab and Olaratumab. Kaposi sarcoma [2B57] [15]
Methotrexate DM2TEOL Major Additive immunosuppressive effects by the combination of Adalimumab and Methotrexate. Leukaemia [2A60-2B33] [15]
Nelarabine DMB6VEG Major Additive immunosuppressive effects by the combination of Adalimumab and Nelarabine. Leukaemia [2A60-2B33] [15]
DTI-015 DMXZRW0 Major Additive immunosuppressive effects by the combination of Adalimumab and DTI-015. Liver cancer [2C12] [15]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Adalimumab and Denosumab. Low bone mass disorder [FB83] [19]
Brigatinib DM7W94S Major Additive immunosuppressive effects by the combination of Adalimumab and Brigatinib. Lung cancer [2C25] [15]
Lurbinectedin DMEFRTZ Major Additive immunosuppressive effects by the combination of Adalimumab and Lurbinectedin. Lung cancer [2C25] [15]
Osimertinib DMRJLAT Major Additive immunosuppressive effects by the combination of Adalimumab and Osimertinib. Lung cancer [2C25] [15]
Belimumab DM3OBQF Major Additive immunosuppressive effects by the combination of Adalimumab and Belimumab. Lupus erythematosus [4A40] [15]
Primaquine DMWQ16I Major Additive immunosuppressive effects by the combination of Adalimumab and Primaquine. Malaria [1F40-1F45] [15]
Inotuzumab ozogamicin DMAC130 Major Additive immunosuppressive effects by the combination of Adalimumab and Inotuzumab ozogamicin. Malignant haematopoietic neoplasm [2B33] [15]
Rituximab DM1YVZT Major Additive immunosuppressive effects by the combination of Adalimumab and Rituximab. Malignant haematopoietic neoplasm [2B33] [15]
Tositumomab DMMYZ3D Major Additive immunosuppressive effects by the combination of Adalimumab and Tositumomab. Malignant haematopoietic neoplasm [2B33] [15]
Fludarabine DMVRLT7 Major Additive immunosuppressive effects by the combination of Adalimumab and Fludarabine. Malignant haematopoietic neoplasm [2B33] [15]
Pentostatin DM0HXDS Major Additive immunosuppressive effects by the combination of Adalimumab and Pentostatin. Mature B-cell leukaemia [2A82] [15]
Ofatumumab DM295PR Major Additive immunosuppressive effects by the combination of Adalimumab and Ofatumumab. Mature B-cell leukaemia [2A82] [15]
Obinutuzumab DM3BVAE Major Additive immunosuppressive effects by the combination of Adalimumab and Obinutuzumab. Mature B-cell leukaemia [2A82] [15]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Adalimumab and Cladribine. Mature B-cell leukaemia [2A82] [13]
Idelalisib DM602WT Major Additive immunosuppressive effects by the combination of Adalimumab and Idelalisib. Mature B-cell leukaemia [2A82] [15]
GDC-0199 DMH0QKA Major Additive immunosuppressive effects by the combination of Adalimumab and GDC-0199. Mature B-cell leukaemia [2A82] [15]
Chlorambucil DMRKE63 Major Additive immunosuppressive effects by the combination of Adalimumab and Chlorambucil. Mature B-cell leukaemia [2A82] [15]
IPI-145 DMWA24P Major Additive immunosuppressive effects by the combination of Adalimumab and IPI-145. Mature B-cell leukaemia [2A82] [15]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Adalimumab and Alemtuzumab. Mature B-cell leukaemia [2A82] [20]
Acalabrutinib DM7GCVW Major Additive immunosuppressive effects by the combination of Adalimumab and Acalabrutinib. Mature B-cell lymphoma [2A85] [15]
Clofarabine DMCVJ86 Major Additive immunosuppressive effects by the combination of Adalimumab and Clofarabine. Mature B-cell lymphoma [2A85] [15]
Blinatumomab DMGECIJ Major Additive immunosuppressive effects by the combination of Adalimumab and Blinatumomab. Mature B-cell lymphoma [2A85] [15]
Ibrutinib DMHZCPO Major Additive immunosuppressive effects by the combination of Adalimumab and Ibrutinib. Mature B-cell lymphoma [2A85] [15]
Vincristine DMINOX3 Major Additive immunosuppressive effects by the combination of Adalimumab and Vincristine. Mature B-cell lymphoma [2A85] [15]
Teniposide DMLW57T Major Additive immunosuppressive effects by the combination of Adalimumab and Teniposide. Mature B-cell lymphoma [2A85] [15]
Tisagenlecleucel DMM9BJD Major Additive immunosuppressive effects by the combination of Adalimumab and Tisagenlecleucel. Mature B-cell lymphoma [2A85] [15]
Mercaptopurine DMTM2IK Major Additive immunosuppressive effects by the combination of Adalimumab and Mercaptopurine. Mature B-cell lymphoma [2A85] [15]
Ponatinib DMYGJQO Major Additive immunosuppressive effects by the combination of Adalimumab and Ponatinib. Mature B-cell lymphoma [2A85] [15]
Cytarabine DMZD5QR Major Additive immunosuppressive effects by the combination of Adalimumab and Cytarabine. Mature B-cell lymphoma [2A85] [15]
Mechlorethamine DM0CVXA Major Additive immunosuppressive effects by the combination of Adalimumab and Mechlorethamine. Mature T-cell lymphoma [2A90] [15]
Dacarbazine DMNPZL4 Major Additive immunosuppressive effects by the combination of Adalimumab and Dacarbazine. Melanoma [2C30] [15]
Ethinyl estradiol DMODJ40 Moderate Altered metabolism of Adalimumab due to Ethinyl estradiol alters the formation of CYP450 enzymes. Menopausal disorder [GA30] [17]
Midazolam DMXOELT Moderate Altered metabolism of Adalimumab due to Midazolam alters the formation of CYP450 enzymes. Mood/affect symptom [MB24] [13]
Carfilzomib DM48K0X Major Additive immunosuppressive effects by the combination of Adalimumab and Carfilzomib. Multiple myeloma [2A83] [15]
Lenalidomide DM6Q7U4 Major Additive immunosuppressive effects by the combination of Adalimumab and Lenalidomide. Multiple myeloma [2A83] [15]
Thalidomide DM70BU5 Major Additive immunosuppressive effects by the combination of Adalimumab and Thalidomide. Multiple myeloma [2A83] [15]
Selinexor DMBD4K3 Major Additive immunosuppressive effects by the combination of Adalimumab and Selinexor. Multiple myeloma [2A83] [15]
Belantamab mafodotin DMBT3AI Major Additive immunosuppressive effects by the combination of Adalimumab and Belantamab mafodotin. Multiple myeloma [2A83] [15]
Elotuzumab DMEYHG9 Major Additive immunosuppressive effects by the combination of Adalimumab and Elotuzumab. Multiple myeloma [2A83] [15]
Daratumumab DMKCIUZ Major Additive immunosuppressive effects by the combination of Adalimumab and Daratumumab. Multiple myeloma [2A83] [15]
Bortezomib DMNO38U Major Additive immunosuppressive effects by the combination of Adalimumab and Bortezomib. Multiple myeloma [2A83] [15]
Melphalan DMOLNHF Major Additive immunosuppressive effects by the combination of Adalimumab and Melphalan. Multiple myeloma [2A83] [15]
Tecfidera DM2OVDT Major Additive immunosuppressive effects by the combination of Adalimumab and Tecfidera. Multiple sclerosis [8A40] [15]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Adalimumab and Siponimod. Multiple sclerosis [8A40] [14]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Adalimumab and Fingolimod. Multiple sclerosis [8A40] [21]
Ocrelizumab DMEZ2KH Major Additive immunosuppressive effects by the combination of Adalimumab and Ocrelizumab. Multiple sclerosis [8A40] [15]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Adalimumab and Ozanimod. Multiple sclerosis [8A40] [13]
Deflazacort DMV0RNS Major Additive immunosuppressive effects by the combination of Adalimumab and Deflazacort. Muscular dystrophy [8C70] [15]
Bexarotene DMOBIKY Major Additive immunosuppressive effects by the combination of Adalimumab and Bexarotene. Mycosis fungoides [2B01] [15]
Romidepsin DMT5GNL Major Additive immunosuppressive effects by the combination of Adalimumab and Romidepsin. Mycosis fungoides [2B01] [15]
Decitabine DMQL8XJ Major Additive immunosuppressive effects by the combination of Adalimumab and Decitabine. Myelodysplastic syndrome [2A37] [15]
Azacitidine DMTA5OE Major Additive immunosuppressive effects by the combination of Adalimumab and Azacitidine. Myelodysplastic syndrome [2A37] [15]
Nilotinib DM7HXWT Major Additive immunosuppressive effects by the combination of Adalimumab and Nilotinib. Myeloproliferative neoplasm [2A20] [15]
Ruxolitinib DM7Q98D Major Additive immunosuppressive effects by the combination of Adalimumab and Ruxolitinib. Myeloproliferative neoplasm [2A20] [15]
Imatinib DM7RJXL Major Additive immunosuppressive effects by the combination of Adalimumab and Imatinib. Myeloproliferative neoplasm [2A20] [15]
Dasatinib DMJV2EK Major Additive immunosuppressive effects by the combination of Adalimumab and Dasatinib. Myeloproliferative neoplasm [2A20] [15]
Hydroxyurea DMOQVU9 Major Additive immunosuppressive effects by the combination of Adalimumab and Hydroxyurea. Myeloproliferative neoplasm [2A20] [15]
Omacetaxine mepesuccinate DMPU2WX Major Additive immunosuppressive effects by the combination of Adalimumab and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [15]
Inebilizumab DMI0RHA Major Additive immunosuppressive effects by the combination of Adalimumab and Inebilizumab. Nervous system paraneoplastic/autoimmune disorder [8E4A] [15]
Atezolizumab DMMF8U0 Major Additive immunosuppressive effects by the combination of Adalimumab and Atezolizumab. Non-small cell lung cancer [2C25] [15]
Olaparib DM8QB1D Major Additive immunosuppressive effects by the combination of Adalimumab and Olaparib. Ovarian cancer [2C73] [15]
Rucaparib DM9PVX8 Major Additive immunosuppressive effects by the combination of Adalimumab and Rucaparib. Ovarian cancer [2C73] [15]
Carboplatin DMG281S Major Additive immunosuppressive effects by the combination of Adalimumab and Carboplatin. Ovarian cancer [2C73] [15]
Altretamine DMKLAYG Major Additive immunosuppressive effects by the combination of Adalimumab and Altretamine. Ovarian cancer [2C73] [15]
MK-4827 DMLYGH4 Major Additive immunosuppressive effects by the combination of Adalimumab and MK-4827. Ovarian cancer [2C73] [15]
Topotecan DMP6G8T Major Additive immunosuppressive effects by the combination of Adalimumab and Topotecan. Ovarian cancer [2C73] [15]
Buprenorphine DMPRI8G Moderate Altered metabolism of Adalimumab due to Buprenorphine alters the formation of CYP450 enzymes. Pain [MG30-MG3Z] [13]
Hydrocodone DMQ2JO5 Moderate Altered metabolism of Adalimumab due to Hydrocodone alters the formation of CYP450 enzymes. Pain [MG30-MG3Z] [13]
Oxycodone DMXLKHV Moderate Altered metabolism of Adalimumab due to Oxycodone alters the formation of CYP450 enzymes. Pain [MG30-MG3Z] [13]
Streptozocin DMOF7AT Major Additive immunosuppressive effects by the combination of Adalimumab and Streptozocin. Pancreatic cancer [2C10] [15]
Levamisole DM5EN79 Major Additive immunosuppressive effects by the combination of Adalimumab and Levamisole. Parasitic infection [1D0Y-1G2Z] [15]
Pemetrexed DMMX2E6 Major Additive immunosuppressive effects by the combination of Adalimumab and Pemetrexed. Pleural mesothelioma [2C26] [15]
Prednisone DM2HG4X Major Additive immunosuppressive effects by the combination of Adalimumab and Prednisone. Postoperative inflammation [1A00-CA43] [15]
Betamethasone DMAHJEF Major Additive immunosuppressive effects by the combination of Adalimumab and Betamethasone. Postoperative inflammation [1A00-CA43] [15]
Hydrocortisone DMGEMB7 Major Additive immunosuppressive effects by the combination of Adalimumab and Hydrocortisone. Postoperative inflammation [1A00-CA43] [15]
Brodalumab DMASDQ6 Major Additive immunosuppressive effects by the combination of Adalimumab and Brodalumab. Psoriasis [EA90] [15]
Efalizumab DMCKL5V Moderate Additive immunosuppressive effects by the combination of Adalimumab and Efalizumab. Psoriasis [EA90] [22]
Infliximab DMH7OIA Major Additive immunosuppressive effects by the combination of Adalimumab and Infliximab. Psoriasis [EA90] [15]
Ustekinumab DMHTYK3 Major Additive immunosuppressive effects by the combination of Adalimumab and Ustekinumab. Psoriasis [EA90] [15]
Tildrakizumab DMLW9HG Major Additive immunosuppressive effects by the combination of Adalimumab and Tildrakizumab. Psoriasis [EA90] [15]
Risankizumab DMM32GT Major Additive immunosuppressive effects by the combination of Adalimumab and Risankizumab. Psoriasis [EA90] [15]
Ixekizumab DMXW92T Major Additive immunosuppressive effects by the combination of Adalimumab and Ixekizumab. Psoriasis [EA90] [15]
Everolimus DM8X2EH Major Additive immunosuppressive effects by the combination of Adalimumab and Everolimus. Renal cell carcinoma [2C90] [15]
Temsirolimus DMS104F Major Additive immunosuppressive effects by the combination of Adalimumab and Temsirolimus. Renal cell carcinoma [2C90] [15]
Fentanyl DM8WAHT Moderate Altered metabolism of Adalimumab due to Fentanyl alters the formation of CYP450 enzymes. Sensation disturbance [MB40] [13]
Sufentanil DMU7YEL Moderate Altered metabolism of Adalimumab due to Sufentanil alters the formation of CYP450 enzymes. Sensation disturbance [MB40] [13]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Adalimumab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [23]
Mogamulizumab DMISH0Z Major Additive immunosuppressive effects by the combination of Adalimumab and Mogamulizumab. Sezary syndrome [2B02] [15]
Floxuridine DM04LR2 Major Additive immunosuppressive effects by the combination of Adalimumab and Floxuridine. Solid tumour/cancer [2A00-2F9Z] [15]
Dactinomycin DM2YGNW Major Additive immunosuppressive effects by the combination of Adalimumab and Dactinomycin. Solid tumour/cancer [2A00-2F9Z] [15]
Methylprednisolone DM4BDON Major Additive immunosuppressive effects by the combination of Adalimumab and Methylprednisolone. Solid tumour/cancer [2A00-2F9Z] [15]
Cyclophosphamide DM4O2Z7 Major Additive immunosuppressive effects by the combination of Adalimumab and Cyclophosphamide. Solid tumour/cancer [2A00-2F9Z] [15]
Vinblastine DM5TVS3 Major Additive immunosuppressive effects by the combination of Adalimumab and Vinblastine. Solid tumour/cancer [2A00-2F9Z] [15]
PDX-101 DM6OC53 Major Additive immunosuppressive effects by the combination of Adalimumab and PDX-101. Solid tumour/cancer [2A00-2F9Z] [15]
Ifosfamide DMCT3I8 Major Additive immunosuppressive effects by the combination of Adalimumab and Ifosfamide. Solid tumour/cancer [2A00-2F9Z] [15]
Docetaxel DMDI269 Major Additive immunosuppressive effects by the combination of Adalimumab and Docetaxel. Solid tumour/cancer [2A00-2F9Z] [15]
Trabectedin DMG3Y89 Major Additive immunosuppressive effects by the combination of Adalimumab and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [15]
Mitoxantrone DMM39BF Major Additive immunosuppressive effects by the combination of Adalimumab and Mitoxantrone. Solid tumour/cancer [2A00-2F9Z] [15]
LEE011 DMMX75K Major Additive immunosuppressive effects by the combination of Adalimumab and LEE011. Solid tumour/cancer [2A00-2F9Z] [15]
Etoposide DMNH3PG Major Additive immunosuppressive effects by the combination of Adalimumab and Etoposide. Solid tumour/cancer [2A00-2F9Z] [15]
Epirubicin DMPDW6T Major Additive immunosuppressive effects by the combination of Adalimumab and Epirubicin. Solid tumour/cancer [2A00-2F9Z] [15]
Prednisolone DMQ8FR2 Major Additive immunosuppressive effects by the combination of Adalimumab and Prednisolone. Solid tumour/cancer [2A00-2F9Z] [15]
Cisplatin DMRHGI9 Major Additive immunosuppressive effects by the combination of Adalimumab and Cisplatin. Solid tumour/cancer [2A00-2F9Z] [15]
Gemcitabine DMSE3I7 Major Additive immunosuppressive effects by the combination of Adalimumab and Gemcitabine. Solid tumour/cancer [2A00-2F9Z] [15]
Norethindrone DMTY169 Moderate Altered metabolism of Adalimumab due to Norethindrone alters the formation of CYP450 enzymes. Solid tumour/cancer [2A00-2F9Z] [17]
Fluorouracil DMUM7HZ Major Additive immunosuppressive effects by the combination of Adalimumab and Fluorouracil. Solid tumour/cancer [2A00-2F9Z] [15]
Taxol DMUOT9V Major Additive immunosuppressive effects by the combination of Adalimumab and Taxol. Solid tumour/cancer [2A00-2F9Z] [15]
Doxorubicin DMVP5YE Major Additive immunosuppressive effects by the combination of Adalimumab and Doxorubicin. Solid tumour/cancer [2A00-2F9Z] [15]
Vinorelbine DMVXFYE Major Additive immunosuppressive effects by the combination of Adalimumab and Vinorelbine. Solid tumour/cancer [2A00-2F9Z] [15]
Warfarin DMJYCVW Moderate Altered metabolism of Adalimumab due to Warfarin alters the formation of CYP450 enzymes. Supraventricular tachyarrhythmia [BC81] [13]
Pomalidomide DMTGBAX Major Additive immunosuppressive effects by the combination of Adalimumab and Pomalidomide. Systemic sclerosis [4A42] [15]
Plicamycin DM7C8YV Major Additive immunosuppressive effects by the combination of Adalimumab and Plicamycin. Testicular cancer [2C80] [15]
Apixaban DM89JLN Moderate Altered metabolism of Adalimumab due to Apixaban alters the formation of CYP450 enzymes. Thrombosis [DB61-GB90] [13]
Dicumarol DMFQCB1 Moderate Altered metabolism of Adalimumab due to Dicumarol alters the formation of CYP450 enzymes. Thrombosis [DB61-GB90] [17]
Trimetrexate DMDEA85 Major Additive immunosuppressive effects by the combination of Adalimumab and Trimetrexate. Toxoplasmosis [1F57] [15]
Muromonab DM8ANCF Major Additive immunosuppressive effects by the combination of Adalimumab and Muromonab. Transplant rejection [NE84] [15]
Sirolimus DMGW1ID Major Additive immunosuppressive effects by the combination of Adalimumab and Sirolimus. Transplant rejection [NE84] [15]
Azathioprine DMMZSXQ Major Additive immunosuppressive effects by the combination of Adalimumab and Azathioprine. Transplant rejection [NE84] [15]
Mycophenolate mofetil DMPQAGE Major Additive immunosuppressive effects by the combination of Adalimumab and Mycophenolate mofetil. Transplant rejection [NE84] [15]
Basiliximab DMWNRZT Major Additive immunosuppressive effects by the combination of Adalimumab and Basiliximab. Transplant rejection [NE84] [15]
Belatacept DMXLYQF Major Additive immunosuppressive effects by the combination of Adalimumab and Belatacept. Transplant rejection [NE84] [15]
Tacrolimus DMZ7XNQ Major Additive immunosuppressive effects by the combination of Adalimumab and Tacrolimus. Transplant rejection [NE84] [15]
Durvalumab DM4PVDY Major Additive immunosuppressive effects by the combination of Adalimumab and Durvalumab. Ureteral cancer [2C92] [15]
Triamcinolone DM98IXF Major Additive immunosuppressive effects by the combination of Adalimumab and Triamcinolone. Vasomotor/allergic rhinitis [CA08] [15]
Disopyramide DM5SYZP Moderate Altered metabolism of Adalimumab due to Disopyramide alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [13]
Mexiletine DMCTE9R Moderate Altered metabolism of Adalimumab due to Mexiletine alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [13]
Procainamide DMNMXR8 Moderate Altered metabolism of Adalimumab due to Procainamide alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [13]
Propafenone DMPIBJK Moderate Altered metabolism of Adalimumab due to Propafenone alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [13]
Flecainide DMSQDLE Moderate Altered metabolism of Adalimumab due to Flecainide alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [13]
Amiodarone DMUTEX3 Moderate Altered metabolism of Adalimumab due to Amiodarone alters the formation of CYP450 enzymes. Ventricular tachyarrhythmia [BC71] [13]
Ganciclovir DM1MBYQ Major Additive immunosuppressive effects by the combination of Adalimumab and Ganciclovir. Virus infection [1A24-1D9Z] [15]
Trifluridine DMG2YBD Major Additive immunosuppressive effects by the combination of Adalimumab and Trifluridine. Virus infection [1A24-1D9Z] [15]
Valganciclovir DMS2IUH Major Additive immunosuppressive effects by the combination of Adalimumab and Valganciclovir. Virus infection [1A24-1D9Z] [15]
⏷ Show the Full List of 217 DDI Information of This Drug

References

1 Management of inflammatory bowel disease. Med J Aust. 2018 Sep 1;209(7):318-323.
2 Hidradenitis Suppurativa: Advances in Diagnosis and Treatment. JAMA. 2017 Nov 28;318(20):2019-2032.
3 Identification of potential molecular mechanisms and candidate drugs for radiotherapy- and chemotherapy-induced mucositis. Support Care Cancer. 2023 Mar 20;31(4):223.
4 Trial of Upadacitinib and Adalimumab for Psoriatic Arthritis. N Engl J Med. 2021 Apr 1;384(13):1227-1239.
5 An update on adalimumab for pyoderma gangrenosum. Drugs Today (Barc). 2021 Sep;57(9):535-542.
6 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4860).
7 Sarcoidosis-associated acro-osteolysis. BMJ Case Rep. 2021 Mar 2;14(3):e240828.
8 First- and Second-Line Pharmacotherapies for Patients With Moderate to Severely Active Ulcerative Colitis: An Updated Network Meta-Analysis. Clin Gastroenterol Hepatol. 2020 Sep;18(10):2179-2191.e6.
9 Trials of anti-tumour necrosis factor therapy for COVID-19 are urgently needed. Lancet. 2020 May 2;395(10234):1407-1409.
10 Cobb R, Boeckh A: Moxidectin: a review of chemistry, pharmacokinetics and use in horses. Parasit Vectors. 2009 Sep 25;2 Suppl 2:S5. doi: 10.1186/1756-3305-2-S2-S5.
11 Veve MP, Wagner JL: Lefamulin: Review of a Promising Novel Pleuromutilin Antibiotic. Pharmacotherapy. 2018 Sep;38(9):935-946. doi: 10.1002/phar.2166. Epub 2018 Aug 20.
12 Adalimumab for psoriasis patients who are non-responders to etanercept: open-label prospective evaluation. J Eur Acad Dermatol Venereol. 2009 Dec;23(12):1394-7.
13 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
14 Cerner Multum, Inc. "Australian Product Information.".
15 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
16 Product Information. Orencia (abatacept). Bristol-Myers Squibb, Princeton, NJ.
17 Product Information. Cosentyx (secukinumab). Novartis Pharmaceuticals, East Hanover, NJ.
18 Argov Z, Mastaglia FL "Drug-induced peripheral neuropathies." Br Med J 1 (1979): 663-6. [PMID: 219931]
19 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
20 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
21 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
22 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
23 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]