Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTM2AOE)

DTT Name Adenosine A2a receptor (ADORA2A)
Synonyms Adenosine receptor A2a; ADORA2; A2a Adenosine receptor; A(2A) adenosine receptor
Gene Name ADORA2A
DTT Type
Successful target
 [1]
BioChemical Class
GPCR rhodopsin
UniProt ID
AA2AR_HUMAN
TTD ID
T77365
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Function The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Receptor for adenosine.
KEGG Pathway
Rap1 signaling pathway (hsa04015 )
Calcium signaling pathway (hsa04020 )
cAMP signaling pathway (hsa04024 )
Neuroactive ligand-receptor interaction (hsa04080 )
Vascular smooth muscle contraction (hsa04270 )
Parkinson's disease (hsa05012 )
Alcoholism (hsa05034 )
Reactome Pathway
Adenosine P1 receptors (R-HSA-417973 )
G alpha (s) signalling events (R-HSA-418555 )
Surfactant metabolism (R-HSA-5683826 )
NGF-independant TRKA activation (R-HSA-187024 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
3 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Caffeine DMKBJWP Allergic rhinitis CA08.0 Approved [1]
Istradefylline DM20VSK Parkinson disease 8A00.0 Approved [2]
Regadenoson DM76VHG Radionuclide imaging N.A. Approved [3]
------------------------------------------------------------------------------------
21 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Apadenoson DMD8QTC Coronary artery disease BA80 Phase 3 [4]
Binodenoson DMVHF8G Hypertension BA00-BA04 Phase 3 [5]
Tozadenant DMATC14 Parkinson disease 8A00.0 Phase 3 [6]
AMP-579 DMJ4GPR Hyperlipidaemia 5C80 Phase 2 [7]
AZD4635 DM8SVIY Prostate cancer 2C82.0 Phase 2 [8]
BIIB014 DMH7RJ1 Parkinson disease 8A00.0 Phase 2 [9]
Dexefaroxan DMTY4KN Parkinson disease 8A00.0 Phase 2 [10]
MRE-0094 DMQR23W Diabetic foot ulcer BD54 Phase 2 [11]
SCH 420814 DMMWCZS Parkinson disease 8A00.0 Phase 2 [9]
Tonapofylline DMBH316 Acute and chronic heart failure BD1Z Phase 2 [12]
UK-432097 DM2O4MI Chronic obstructive pulmonary disease CA22 Phase 2 [13]
AB928 DMDOXMN Metastatic colorectal cancer 2B91 Phase 1/2 [8]
ATL-313 DM75QY9 Arteriosclerosis BD40 Phase 1/2 [14]
OPA-6566 DMELJIV Glaucoma/ocular hypertension 9C61 Phase 1/2 [15]
PBF509 DMGFPQ0 Non-small-cell lung cancer 2C25.Y Phase 1/2 [8]
V81444 DMPWHU6 Parkinson disease 8A00.0 Phase 1/2 [16]
EOS100850 DMQ6GUY Solid tumour/cancer 2A00-2F9Z Phase 1 [17]
GW-328267 DMM1RB6 Allergic rhinitis CA08.0 Phase 1 [18]
KF-17837 DMQ6DLZ Parkinson disease 8A00.0 Phase 1 [19]
PBF-999 DMBSQH9 Huntington disease 8A01.10 Phase 1 [20]
SCH-442416 DMQ2K1V N. A. N. A. Phase 1 [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Clinical Trial Drug(s)
8 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PF-1913539 DMXEU14 Alzheimer disease 8A20 Discontinued in Phase 3 [22]
BVT-115959 DM43JK0 Pain MG30-MG3Z Discontinued in Phase 2 [23]
Lu-AA47070 DML86MJ Parkinson disease 8A00.0 Discontinued in Phase 1 [24]
T-62 DMQVLZH Neuropathic pain 8E43.0 Discontinued in Phase 1 [25]
ARISTEROMYCIN DMRXB74 N. A. N. A. Terminated [26]
METHYLTHIOADENOSINE DMC8J6F Multiple sclerosis 8A40 Terminated [27]
METRIFUDIL DMS5CZ4 N. A. N. A. Terminated [28]
ZM-241385 DMWQ38G N. A. N. A. Terminated [29]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Discontinued Drug(s)
220 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(1H-Imidazo[4,5-c]quinolin-4-yl)-phenyl-amine HCl DM4FSTL Discovery agent N.A. Investigative [30]
(2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol DM852Z6 Discovery agent N.A. Investigative [31]
(3-amino-5-bromobenzofuran-2-yl)(phenyl)methanone DMP2G5W Discovery agent N.A. Investigative [32]
(E,E)-8-(4-Phenylbutadien-1-yl)caffeine DMPIUKZ Discovery agent N.A. Investigative [33]
(E,E)-8-[4-(3-Bromophenyl)butadien-1-yl]caffeine DMPEV7S Discovery agent N.A. Investigative [33]
(E,E)-8-[4-(3-Chlorophenyl)butadien-1-yl]caffeine DMY4W25 Discovery agent N.A. Investigative [33]
(E,E)-8-[4-(3-Fluorophenyl)butadien-1-yl]caffeine DMPHJO2 Discovery agent N.A. Investigative [33]
(S)-DHPA DMQSC21 Discovery agent N.A. Investigative [34]
(Z)-8-(3-chlorostyryl)caffeine DMOB9E4 Discovery agent N.A. Investigative [33]
1,3,7-Tripropyl-3,7-dihydro-purine-2,6-dione DMNCJ5R Discovery agent N.A. Investigative [35]
1,3,8-Trimethyl-3,7-dihydro-purine-2,6-dione DMOZEKU Discovery agent N.A. Investigative [36]
1,3-Diallyl-3,7-dihydro-purine-2,6-dione DMEV8G2 Discovery agent N.A. Investigative [37]
1,3-Diallyl-7-methyl-3,7-dihydro-purine-2,6-dione DM4G2IE Discovery agent N.A. Investigative [35]
1,3-Dibenzyl-3,7-dihydro-purine-2,6-dione DM2WSG5 Discovery agent N.A. Investigative [35]
1,3-Diethyl-3,7-dihydro-purine-2,6-dione DMKYE16 Discovery agent N.A. Investigative [37]
1,3-Diisobutyl-3,7-dihydro-purine-2,6-dione DMZ80CT Discovery agent N.A. Investigative [35]
1,3-Dipropyl-3,7-dihydro-purine-2,6-dione DMUL2B3 Discovery agent N.A. Investigative [37]
1,4-diaminoanthracene-9,10-dione DMIHYKG Discovery agent N.A. Investigative [32]
1-Allyl-3,7-dimethyl-3,7-dihydro-purine-2,6-dione DMZE5GX Discovery agent N.A. Investigative [35]
1-amino-2,4-bis(phenylthio)anthracene-9,10-dione DMRAN9T Discovery agent N.A. Investigative [32]
1-amino-2-phenoxyanthracene-9,10-dione DMWCXM4 Discovery agent N.A. Investigative [32]
1-amino-4-chloroanthracene-9,10-dione DMJMDNX Discovery agent N.A. Investigative [32]
1-amino-4-methoxyanthracene-9,10-dione DM7X5BP Discovery agent N.A. Investigative [32]
1-aminoanthracene-9,10-dione DMGU76I Discovery agent N.A. Investigative [32]
1-Butyl-8-phenyl-3,7-dihydro-purine-2,6-dione DMSNK98 Discovery agent N.A. Investigative [38]
1-Ethyl-3-methyl-3,7-dihydro-purine-2,6-dione DMSFINY Discovery agent N.A. Investigative [35]
1-Methyl-8-phenyl-3,7-dihydro-purine-2,6-dione DMSTH24 Discovery agent N.A. Investigative [38]
1-METHYLXANTHINE DM2WQ1E Discovery agent N.A. Investigative [37]
1-Phenyl-3-(4-pyridin-2-yl-thiazol-2-yl)-urea DMJ723D Discovery agent N.A. Investigative [39]
1H-Imidazo[4,5-c]quinolin-4-ylamine HCl DMME09C Discovery agent N.A. Investigative [30]
2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine DMMESIU Discovery agent N.A. Investigative [40]
2,6,8-triphenyl-9H-purine DM4IFPQ Discovery agent N.A. Investigative [41]
2,6-diphenyl-1-deazapurine DMW2VZ1 Discovery agent N.A. Investigative [42]
2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine DMY3C78 Discovery agent N.A. Investigative [42]
2,6-diphenyl-8-ethyl-1-deazapurine DM0C8BW Discovery agent N.A. Investigative [42]
2,6-diphenyl-8-methyl-1-deazapurine DMI79FV Discovery agent N.A. Investigative [42]
2,6-diphenyl-8-tButyl-1-deazapurine DM6D1BQ Discovery agent N.A. Investigative [42]
2,6-diphenyl-9H-purine DM5SXYI Discovery agent N.A. Investigative [41]
2,6-Diphenyl-pyrimidin-4-ylamine DM3JURW Discovery agent N.A. Investigative [43]
2,6-dphenyl-8-propyl-1-deazapurine DM8F9KO Discovery agent N.A. Investigative [42]
2-(1H-benzo[d]imidazol-2-yl)quinoxaline DM0Y2P1 Discovery agent N.A. Investigative [44]
2-(2''-indolylethyloxy)adenosine DMCLIN8 Discovery agent N.A. Investigative [45]
2-(2-furyl)-6-(1H-pyrazol-1-yl)pyrimidin-4-amine DMXGWOT Discovery agent N.A. Investigative [46]
2-(3''(5''-chloro-indolyl)ethyloxy)adenosine DMD8Q3E Discovery agent N.A. Investigative [45]
2-(3''(7''-bromo-indolyl)ethyloxy)adenosine DMITEND Discovery agent N.A. Investigative [45]
2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine DMXRHOY Discovery agent N.A. Investigative [45]
2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine DMR8PGZ Discovery agent N.A. Investigative [45]
2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine DME3IN1 Discovery agent N.A. Investigative [45]
2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine DM6BIOP Discovery agent N.A. Investigative [45]
2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine DMFP0IW Discovery agent N.A. Investigative [45]
2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine DMWA0MN Discovery agent N.A. Investigative [45]
2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine DMGRC24 Discovery agent N.A. Investigative [45]
2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine DML39UW Discovery agent N.A. Investigative [45]
2-(3''-(benzoimidazole-1''-yl)ethyloxy)adenosine DMLDOH6 Discovery agent N.A. Investigative [45]
2-(3''-indolylethyloxy)adenosine DMXRAE3 Discovery agent N.A. Investigative [45]
2-(3''-pyrrolylethyloxy)adenosine DMNCP8Y Discovery agent N.A. Investigative [45]
2-(4-chlorophenyl)-6-phenyl-9H-purine DMAPWNR Discovery agent N.A. Investigative [41]
2-(4-ethylthiobenzimidazol-2-yl)quinoxaline DMTAVU5 Discovery agent N.A. Investigative [47]
2-(4-hydroxypent-1-yl)-N6-methoxyadenosine DM1C864 Discovery agent N.A. Investigative [48]
2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline DMDXIN1 Discovery agent N.A. Investigative [44]
2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine DMSIJ17 Discovery agent N.A. Investigative [48]
2-(6-amino-8-bromo-9H-purin-9-yl)ethanol DMRBX1D Discovery agent N.A. Investigative [49]
2-(hex-1-ynyl)-N6-methoxyadenosine DM7YLTS Discovery agent N.A. Investigative [48]
2-amino-3-(m-tolylamino)naphthalene-1,4-dione DM2GJZE Discovery agent N.A. Investigative [32]
2-Amino-4,6-di-furan-2-yl-nicotinonitrile DMVN0EC Discovery agent N.A. Investigative [50]
2-Amino-4,6-di-thiophen-2-yl-nicotinonitrile DM53T8Q Discovery agent N.A. Investigative [50]
2-Amino-4,6-diphenyl-nicotinonitrile DMO69TS Discovery agent N.A. Investigative [50]
2-Amino-4,6-diphenyl-pyrimidin-5-carbonitrile DM1MOB9 Discovery agent N.A. Investigative [43]
2-Amino-4,6-diphenyl-pyrimidine DMI9YGU Discovery agent N.A. Investigative [43]
2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile DMP4NHD Discovery agent N.A. Investigative [50]
2-Amino-4-phenyl-6-thiophen-2-yl-nicotinonitrile DMRVTJ1 Discovery agent N.A. Investigative [50]
2-Amino-6-furan-2-yl-4-phenyl-nicotinonitrile DMUYTXS Discovery agent N.A. Investigative [50]
2-amino-6-phenyl-4-p-tolylnicotinonitrile DMAXESK Discovery agent N.A. Investigative [51]
2-Amino-6-phenyl-4-thiophen-2-yl-nicotinonitrile DM7M9CL Discovery agent N.A. Investigative [50]
2-amino-N-benzyl-6-phenyl-9H-purine-9-carboxamide DM320RW Discovery agent N.A. Investigative [52]
2-chloro-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine DMPCRLY Discovery agent N.A. Investigative [53]
2-chloro-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine DMC5OQ3 Discovery agent N.A. Investigative [53]
2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine DM6CZAN Discovery agent N.A. Investigative [30]
2-ethyl-4-(furan-2-yl)thieno[3,2-d]pyrimidine DM0BHKM Discovery agent N.A. Investigative [53]
2-ethyl-4-(furan-3-yl)thieno[3,2-d]pyrimidine DMR0IEK Discovery agent N.A. Investigative [53]
2-ethyl-4-(pyridin-2-yl)thieno[3,2-d]pyrimidine DMWFR16 Discovery agent N.A. Investigative [53]
2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine DMWCGE8 Discovery agent N.A. Investigative [53]
2-ethyl-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine DMIRSQO Discovery agent N.A. Investigative [53]
2-ethynyl-N6-methoxyadenosine DM2D78W Discovery agent N.A. Investigative [48]
2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine DMIMRCH Discovery agent N.A. Investigative [54]
2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine DM9MIC5 Discovery agent N.A. Investigative [54]
2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine DMDC6XP Discovery agent N.A. Investigative [30]
2-phenyl-2H-pyrazolo[3,4-c]quinolin-4-amine DM5WOSM Discovery agent N.A. Investigative [54]
2-phenylpropoxyadenosine DMZQCEP Discovery agent N.A. Investigative [45]
2-tolyl-6-phenyl-9H-purine DM1HABS Discovery agent N.A. Investigative [41]
2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine DMKC1GI Discovery agent N.A. Investigative [48]
2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine DMTNQZU Discovery agent N.A. Investigative [48]
3-Benzyl-7-methyl-[1,8]naphthyridin-4-ol DMHQ467 Discovery agent N.A. Investigative [55]
3-Benzyl-7-methyl-[1,8]naphthyridine-4-thiol DM12RH3 Discovery agent N.A. Investigative [55]
3-Isopropyl-1-methyl-3,7-dihydro-purine-2,6-dione DMYKVRF Discovery agent N.A. Investigative [35]
3-noradamantyl-1,3-dipropylxanthine DMFHYAE Discovery agent N.A. Investigative [56]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one DMM9X0G Discovery agent N.A. Investigative [57]
4-(ethylthio)-6-phenyl-1,3,5-triazin-2-amine DM0GCEK Discovery agent N.A. Investigative [51]
4-(furan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine DMY7035 Discovery agent N.A. Investigative [58]
4-(furan-2-yl)thieno[3,2-d]pyrimidin-2-amine DM7LVKP Discovery agent N.A. Investigative [52]
4-(thiazol-2-yl)thieno[3,2-d]pyrimidin-2-amine DMK3J8Q Discovery agent N.A. Investigative [53]
4-Amino-2,6-diphenyl-pyrimidine-5-carbonitrile DM7X59V Discovery agent N.A. Investigative [43]
4-amino-2-p-tolylisoindoline-1,3-dione DMOJTZD Discovery agent N.A. Investigative [32]
5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol DMZLOVB Discovery agent N.A. Investigative [59]
5,7-diphenyl-3H-imidazo[4,5-b]pyridin-2-ol DM4TIXY Discovery agent N.A. Investigative [42]
5-Azido-6-benzyl-2-methyl-[1,8]naphthyridine DMURTHE Discovery agent N.A. Investigative [55]
5-Butyl-8-phenyl-3H-[1,2,4]triazolo[5,1-i]purine DM2EPFZ Discovery agent N.A. Investigative [60]
6-(furan-2-yl)-9H-purin-2-amine DMOYCBH Discovery agent N.A. Investigative [58]
6-Furan-2-yl-9-phenethyl-9H-purin-2-ylamine DMOLIW4 Discovery agent N.A. Investigative [61]
6-Furan-2-yl-9-phenyl-9H-purin-2-ylamine DMSJP6T Discovery agent N.A. Investigative [61]
6-guanidino-2-(3''-indolylethyloxy)adenosine DMM86PK Discovery agent N.A. Investigative [45]
7-Allyl-1,3-dimethyl-3,7-dihydro-purine-2,6-dione DMPRBO1 Discovery agent N.A. Investigative [35]
7-Allyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione DMHJ6TU Discovery agent N.A. Investigative [35]
7-Isopropyl-7H-adenine DMVSF0O Discovery agent N.A. Investigative [34]
7-Propyl-7H-adenine DM4I0B1 Discovery agent N.A. Investigative [34]
8-Br-adenine DMVPIYG Discovery agent N.A. Investigative [34]
8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine DMMQ79W Discovery agent N.A. Investigative [34]
8-Bromo-9-(2-butyl)-9H-adenine DM5DCPF Discovery agent N.A. Investigative [34]
8-Bromo-9-(2-hydroxypropyl)-9H-adenine DMKW2PE Discovery agent N.A. Investigative [34]
8-Bromo-9-(3-hydroxypropyl)-9H-adenine DMA258T Discovery agent N.A. Investigative [34]
8-Bromo-9-(but-3-enyl)-9H-adenine DMXNF3V Discovery agent N.A. Investigative [34]
8-Bromo-9-(sec-butyl)-9H-adenine DMSQPFM Discovery agent N.A. Investigative [34]
8-Bromo-9-cyclobutyl-9H-adenine DMUTV76 Discovery agent N.A. Investigative [34]
8-Bromo-9-cyclohexyl-9H-adenine DMLVCON Discovery agent N.A. Investigative [34]
8-Bromo-9-cyclopentyl-9H-adenine DMCK0O1 Discovery agent N.A. Investigative [34]
8-Bromo-9-ethyl-9H-adenine DM4YAD6 Discovery agent N.A. Investigative [34]
8-bromo-9-isobutyl-9H-purin-6-amine DMZF3UN Discovery agent N.A. Investigative [49]
8-Bromo-9-isopropyl-9H-adenine DMIN9HC Discovery agent N.A. Investigative [34]
8-Bromo-9-methyl-9H-adenine DM1DS3B Discovery agent N.A. Investigative [34]
8-Bromo-9-phenylethyl-9H-adenine DMB7EWZ Discovery agent N.A. Investigative [34]
8-Bromo-9-propyl-9H-adenine DMRIPU5 Discovery agent N.A. Investigative [34]
8-PHENYL THEOPHYLLINE DMFGUCY Discovery agent N.A. Investigative [30]
8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione DMHQGOC Discovery agent N.A. Investigative [38]
8-propyl-2,6-diphenyl-9H-purine DMT6YUF Discovery agent N.A. Investigative [41]
9-(2-Hydroxyethyl)-9H-adenine DMYUMHG Discovery agent N.A. Investigative [34]
9-(2-Hydroxypropyl)-9H-adenine DM2UQ0R Discovery agent N.A. Investigative [34]
9-(3-aminobenzyl)-6-(furan-2-yl)-9H-purin-2-amine DMDYZCH Discovery agent N.A. Investigative [52]
9-(3-Hydroxypropyl)-9H-adenine DM80MTI Discovery agent N.A. Investigative [34]
9-(3-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine DM4X18V Discovery agent N.A. Investigative [52]
9-(4-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine DMURKL9 Discovery agent N.A. Investigative [52]
9-(sec-Butyl)-9H-adenine DMFKVPA Discovery agent N.A. Investigative [34]
9-Allyl-8-bromo-9H-adenine DM8VZIY Discovery agent N.A. Investigative [34]
9-benzyl-6-(furan-2-yl)-9H-purin-2-amine DMO6CB7 Discovery agent N.A. Investigative [52]
9-Benzyl-8-bromo-9H-adenine DMMWGVI Discovery agent N.A. Investigative [34]
9-BENZYL-9H-ADENINE DMONCUL Discovery agent N.A. Investigative [34]
9-But-3-enyl-9H-adenine DMSWQY7 Discovery agent N.A. Investigative [34]
9-Butyl-9H-adenine DMZQLBD Discovery agent N.A. Investigative [34]
9-Cyclobutyl-9H-adenine DM04QWX Discovery agent N.A. Investigative [34]
9-Cycloheptyl-9H-adenine DMP8VM2 Discovery agent N.A. Investigative [34]
9-Cyclopentyl-9H-adenine DMSGU2L Discovery agent N.A. Investigative [34]
9-Cyclopropyl-9H-adenine DMAFCZL Discovery agent N.A. Investigative [34]
9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine DMRVS2D Discovery agent N.A. Investigative [62]
9-Ethyl-9H-adenine DMWV8YX Discovery agent N.A. Investigative [34]
9-Isopropyl-9H-adenine DMBQLAI Discovery agent N.A. Investigative [34]
9-Methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine DMO4CSP Discovery agent N.A. Investigative [63]
9-Methyl-9H-adenine DM6DOVL Discovery agent N.A. Investigative [34]
9-Phenylethyl-9H-adenine DMO17J0 Discovery agent N.A. Investigative [34]
9-Propyl-9H-adenine DMQTEPY Discovery agent N.A. Investigative [34]
Alloxazine DM7U2BE Discovery agent N.A. Investigative [63]
CGS 21680 DMZ0TGY Discovery agent N.A. Investigative [64]
Cyclohexyl-(2-phenoxy-9H-purin-6-yl)-amine DM84ZX5 Discovery agent N.A. Investigative [65]
Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine DMLREDJ Discovery agent N.A. Investigative [65]
Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate DMK4T5Y Discovery agent N.A. Investigative [12]
FR-166124 DMPCBXT Discovery agent N.A. Investigative [66]
Galangin DM5TQ2O Discovery agent N.A. Investigative [67]
GNF-PF-2224 DM26UKN Discovery agent N.A. Investigative [68]
GNF-PF-2700 DMC56YJ Discovery agent N.A. Investigative [49]
isobutylmethylxanthine DM46F5X Discovery agent N.A. Investigative [35]
Isoguanosine DMAFLCJ Discovery agent N.A. Investigative [69]
Kuanoniamine D DMAVM94 Discovery agent N.A. Investigative [70]
LUF-5417 DMUPQED Discovery agent N.A. Investigative [12]
LUF-5433 DME4O5D Discovery agent N.A. Investigative [12]
LUF-5437 DM0DRO8 Discovery agent N.A. Investigative [39]
LUF-5767 DMP08QO Discovery agent N.A. Investigative [71]
LUF-5956 DMG4YWM Discovery agent N.A. Investigative [41]
LUF-5957 DMJFMH9 Discovery agent N.A. Investigative [41]
LUF-5962 DMR6LIE Discovery agent N.A. Investigative [41]
LUF-5978 DMCTM3L Discovery agent N.A. Investigative [42]
LUF-5980 DMGOIF5 Discovery agent N.A. Investigative [42]
LUF-5981 DMHO3XL Discovery agent N.A. Investigative [42]
Methyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate DMBLW1A Discovery agent N.A. Investigative [72]
MSX-3 DMF9HYI Parkinson disease 8A00.0 Investigative [73]
N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine DM3C8PJ Discovery agent N.A. Investigative [65]
N-(2,6-diphenylpyrimidin-4-yl)-2-ethylbutyramide DMK5AU4 Discovery agent N.A. Investigative [71]
N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide DM6HGK4 Discovery agent N.A. Investigative [71]
N-(2,6-diphenylpyrimidin-4-yl)acetamide DMQ0DMU Discovery agent N.A. Investigative [71]
N-(2,6-diphenylpyrimidin-4-yl)butyramide DM5EF71 Discovery agent N.A. Investigative [71]
N-(2,6-diphenylpyrimidin-4-yl)isobutyramide DMWPZCS Discovery agent N.A. Investigative [71]
N-(2,6-diphenylpyrimidin-4-yl)propionamide DM89NGE Discovery agent N.A. Investigative [71]
N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide DMLTROU Discovery agent N.A. Investigative [74]
N-(3-Phenyl-[1,2,4]thiadiazol-5-yl)-benzamide DM4IA92 Discovery agent N.A. Investigative [39]
N-(4,6-diphenylpyrimidin-2-yl)propionamide DMJZ2IP Discovery agent N.A. Investigative [71]
N-(4-Pyridin-2-yl-thiazol-2-yl)-benzamide DMHBWM9 Discovery agent N.A. Investigative [39]
N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide DMTF8US Discovery agent N.A. Investigative [12]
N-(7-methoxy-4-phenylbenzofuran-2-yl)acetamide DMH42L8 Discovery agent N.A. Investigative [72]
N6-((+/-)-endo-norborn-2-yl)adenosine DM30KXV Discovery agent N.A. Investigative [40]
N6-(4-hydroxybenzyl)adenine riboside DM5Q71U Discovery agent N.A. Investigative [75]
N6-CYCLOPENTYLADENOSINE DMD6AJO Discovery agent N.A. Investigative [12]
N6-methoxy-2-phenylethynyladenosine DMDG59X Discovery agent N.A. Investigative [48]
N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine DMSEL5W Discovery agent N.A. Investigative [48]
N6-methoxy-2-[(3-pyridinyl)ethynyl]-adenosine DMP7246 Discovery agent N.A. Investigative [48]
N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine DM8LR62 Discovery agent N.A. Investigative [48]
N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine DMQ5K8R Discovery agent N.A. Investigative [48]
N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine DM9H3W8 Discovery agent N.A. Investigative [48]
N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine DMRBS50 Discovery agent N.A. Investigative [48]
N6-[(4-Amino)-phenyl]-9-benzyl-2-phenyladenine DM0WMKJ Discovery agent N.A. Investigative [76]
N6-[(4-Nitro)-phenyl]-9-benzyl-2-phenyladenine DMVNLPF Discovery agent N.A. Investigative [76]
PD-115199 DMQ4LRZ Discovery agent N.A. Investigative [77]
Phenyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate DMWN9XU Discovery agent N.A. Investigative [72]
Phenyl(2-(trifluoromethyl)quinolin-4-yl)methanol DMDV1SN Discovery agent N.A. Investigative [78]
PSB-0788 DM0FKV9 Discovery agent N.A. Investigative [79]
PSB-09120 DMAFHLX Discovery agent N.A. Investigative [79]
PSB-601 DMBIK7D Discovery agent N.A. Investigative [79]
R-N6-(phenylisopropyl)adenosine DM2N3BA Discovery agent N.A. Investigative [45]
SB-298 DMU2J3K Discovery agent N.A. Investigative [79]
SCH-63390 DMAUB9F Discovery agent N.A. Investigative [80]
ST-1535 DMUTC9Z Discovery agent N.A. Investigative [50]
[3H]CCPA DMHDGB3 Discovery agent N.A. Investigative [81]
[3H]NECA DMAO9SH Discovery agent N.A. Investigative [82]
[3H]OSIP339391 DM4BY5J Discovery agent N.A. Investigative [49]
------------------------------------------------------------------------------------
⏷ Show the Full List of 220 Investigative Drug(s)

References

1 Caffeine as a psychomotor stimulant: mechanism of action. Cell Mol Life Sci. 2004 Apr;61(7-8):857-72.
2 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
3 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
4 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3290).
5 Coronary circulation responses to binodenoson, a selective adenosine A2A receptor agonist. Am J Cardiol. 2007 Jun 1;99(11):1507-12.
6 Tozadenant (SYN115) in patients with Parkinson's disease who have motor fluctuations on levodopa: a phase 2b, double-blind, randomised trial. Lancet Neurol. 2014 Aug;13(8):767-76.
7 Adenosine A1/A2a receptor agonist AMP-579 induces acute and delayed preconditioning against in vivo myocardial stunning. Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2746-53.
8 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
9 Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
10 The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
11 Emerging drugs for diabetic foot ulcers. Expert Opin Emerg Drugs. 2006 Nov;11(4):709-24.
12 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem. 2010 Mar 15;18(6):2195-2203.
13 Structure of an agonist-bound human A2A adenosine receptor. Science. 2011 Apr 15;332(6027):322-7.
14 Effect of novel A2A adenosine receptor agonist ATL 313 on Clostridium difficile toxin A-induced murine ileal enteritis. Infect Immun. 2006 May;74(5):2606-12.
15 Clinical pipeline report, company report or official report of Acucela.
16 Adenosine A2A receptor antagonists in Parkinson's disease: progress in clinical trials from the newly approved istradefylline to drugs in early development and those already discontinued. CNS Drugs. 2014 May;28(5):455-74.
17 National Cancer Institute Drug Dictionary (drug name EOS100850).
18 ADENOSINE RECEPTORS AS TARGETS FOR THERAPEUTIC INTERVENTION IN ASTHMA AND CHRONIC OBSTRUCTIVE PULMONARY DISEASE
19 Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine. J Med Chem. 1993 Nov 12;36(23):3731-3.
20 Clinical pipeline report, company report or official report of Palobiofarma.
21 Design, radiosynthesis, and biodistribution of a new potent and selective ligand for in vivo imaging of the adenosine A(2A) receptor system using p... J Med Chem. 2000 Nov 16;43(23):4359-62.
22 Blockade of A2A adenosine receptors prevents basic fibroblast growth factor-induced reactive astrogliosis in rat striatal primary astrocytes. Glia. 2003 Aug;43(2):190-4.
23 Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May;1808(5):1290-308.
24 The novel adenosine A2A antagonist Lu AA47070 reverses the motor and motivational effects produced by dopamine D2 receptor blockade. Pharmacol Biochem Behav. 2012 Jan;100(3):498-505.
25 Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
26 Methanocarba analogues of purine nucleosides as potent and selective adenosine receptor agonists. J Med Chem. 2000 Jun 1;43(11):2196-203.
27 Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique aden... J Med Chem. 2004 Apr 22;47(9):2243-55.
28 N-substituted adenosines as novel neuroprotective A(1) agonists with diminished hypotensive effects. J Med Chem. 1999 Sep 9;42(18):3463-77.
29 2-Phenylpyrazolo[4,3-d]pyrimidin-7-one as a new scaffold to obtain potent and selective human A3 adenosine receptor antagonists: new insights into ... J Med Chem. 2009 Dec 10;52(23):7640-52.
30 1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. J Med Chem. 1991 Mar;34(3):1202-6.
31 Structure-activity relationships of 9-alkyladenine and ribose-modified adenosine derivatives at rat A3 adenosine receptors. J Med Chem. 1995 May 12;38(10):1720-35.
32 Structure-based discovery of novel chemotypes for adenosine A(2A) receptor antagonists. J Med Chem. 2010 Feb 25;53(4):1799-809.
33 Dual inhibition of monoamine oxidase B and antagonism of the adenosine A(2A) receptor by (E,E)-8-(4-phenylbutadien-1-yl)caffeine analogues. Bioorg Med Chem. 2008 Sep 15;16(18):8676-84.
34 8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. Bioorg Med Chem. 2009 Apr 1;17(7):2812-22.
35 Analogues of caffeine and theophylline: effect of structural alterations on affinity at adenosine receptors. J Med Chem. 1986 Jul;29(7):1305-8.
36 1,3-Dialkyl-8-(p-sulfophenyl)xanthines: potent water-soluble antagonists for A1- and A2-adenosine receptors. J Med Chem. 1985 Apr;28(4):487-92.
37 Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. J Med Chem. 1988 Oct;31(10):2034-9.
38 Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic... J Med Chem. 2004 Feb 12;47(4):1031-43.
39 Thiazole and thiadiazole analogues as a novel class of adenosine receptor antagonists. J Med Chem. 2001 Mar 1;44(5):749-62.
40 N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine recept... J Med Chem. 2009 Apr 23;52(8):2393-406.
41 2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists. J Med Chem. 2006 May 18;49(10):2861-7.
42 2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem. 2007 Feb 22;50(4):828-34.
43 A new generation of adenosine receptor antagonists: from di- to trisubstituted aminopyrimidines. Bioorg Med Chem. 2008 Mar 15;16(6):2741-52.
44 Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists. J Med Chem. 2008 Mar 27;51(6):1764-70.
45 Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor. J Med Chem. 2007 Apr 19;50(8):1810-27.
46 Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy. J Med Chem. 2008 Feb 14;51(3):400-6.
47 2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database search... J Med Chem. 2005 Dec 29;48(26):8253-60.
48 N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor. J Med Chem. 2007 Mar 22;50(6):1222-30.
49 Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. Eur J Med Chem. 2010 Aug;45(8):3459-71.
50 2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. J Med Chem. 2008 Aug 14;51(15):4449-55.
51 Identification of non-furan containing A2A antagonists using database mining and molecular similarity approaches. Bioorg Med Chem Lett. 2006 Dec 1;16(23):5993-7.
52 Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidines and 6-arylpu... Bioorg Med Chem Lett. 2008 May 1;18(9):2924-9.
53 Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3.
54 New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluati... J Med Chem. 2007 Aug 23;50(17):4061-74.
55 1,8-Naphthyridin-4-one derivatives as new ligands of A2A adenosine receptors. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4604-10.
56 Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. J Med Chem. 2006 Nov 30;49(24):7119-31.
57 Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
58 Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. J Med Chem. 2009 Jan 8;52(1):33-47.
59 Synthesis of eudistomin D analogues and its effects on adenosine receptors. Bioorg Med Chem. 2008 Apr 1;16(7):3825-30.
60 Facile synthesis of fused 1,2,4-triazolo[1,5-c]pyrimidine derivatives as human adenosine A3 receptor ligands. Bioorg Med Chem Lett. 2004 May 17;14(10):2443-6.
61 6-(2-Furanyl)-9H-purin-2-amine derivatives as A2A adenosine antagonists. Bioorg Med Chem Lett. 2005 Apr 15;15(8):2119-22.
62 Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor. Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4.
63 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacolog... J Med Chem. 2005 Nov 3;48(22):6887-96.
64 Effects of CGS 21680, a selective adenosine A2A receptor agonist, on allergic airways inflammation in the rat. Eur J Pharmacol. 2002 Mar 8;438(3):183-8.
65 Reversine and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem. 2005 Jul 28;48(15):4910-8.
66 Discovery of FR166124, a novel water-soluble pyrazolo-[1,5-a]pyridine adenosine A1 receptor antagonist. Bioorg Med Chem Lett. 1999 Jul 19;9(14):1979-84.
67 Mutagenesis reveals structure-activity parallels between human A2A adenosine receptors and biogenic amine G protein-coupled receptors. J Med Chem. 1997 Aug 1;40(16):2588-95.
68 Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine r... Eur J Med Chem. 2010 May;45(5):1739-45.
69 High selectivity of novel isoguanosine analogues for the adenosine A1 receptor. Bioorg. Med. Chem. Lett. 1(9):481-486 (1991).
70 Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp. J Nat Prod. 1998 Feb;61(2):301-5.
71 2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists. J Med Chem. 2004 Dec 16;47(26):6529-40.
72 Synthetic studies on selective adenosine A2A receptor antagonists: synthesis and structure-activity relationships of novel benzofuran derivatives. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1090-3.
73 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5610).
74 Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700.
75 Neuroprotective principles from Gastrodia elata. J Nat Prod. 2007 Apr;70(4):571-4.
76 N6-1,3-diphenylurea derivatives of 2-phenyl-9-benzyladenines and 8-azaadenines: synthesis and biological evaluation as allosteric modulators of A2A... Eur J Med Chem. 2008 Aug;43(8):1639-47.
77 (E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. J Med Chem. 1992 Jun 12;35(12):2342-5.
78 Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2916-9.
79 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with... J Med Chem. 2009 Jul 9;52(13):3994-4006.
80 Design, synthesis, and biological evaluation of a second generation of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as potent and selective A2A... J Med Chem. 1998 Jun 4;41(12):2126-33.
81 5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 ... Bioorg Med Chem. 2008 Jan 1;16(1):336-53.
82 Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. J Med Chem. 1988 Jun;31(6):1179-83.