Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTOM3J0)

• DTT Name: Estrogen receptor beta (ESR2)
• Synonyms: Oestrogen receptor beta; Nuclear receptor subfamily 3 group A member 2; NR3A2; Erbeta; ESTRB; ER-beta; Beta-1
• Gene Name: ESR2
• DTT Type: Successful target; [1]
• BioChemical Class: Nuclear hormone receptor
• UniProt ID: ESR2_HUMAN
• TTD ID: T80896
• Sequence:
  MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
  NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
  RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
  NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
  CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
  LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
  VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
  DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
  CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
• Function: Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. Nuclear hormone receptor.
• KEGG Pathway:
  Estrogen signaling pathway (hsa04915)
  Prolactin signaling pathway (hsa04917)
• Reactome Pathway: Nuclear Receptor transcription pathway (R-HSA-383280)

Molecular Interaction Atlas (MIA) of This DTT

4 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ARZOXIFENE	DMOKCVI	Breast cancer	2C60-2C65	Approved	[2]
Conjugated Estrogens	DMLT0E1	Dyspareunia	GA12	Approved	[1]
Estrogen	DMGY0UT	Menopause symptom	GA30.0	Approved	[3]
Trilostane	DMQZ9GF	Cushing disease	5A70	Approved	[4]

8 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MF-101	DM8Z0I3	Hepatitis virus infection	1E50-1E51	Phase 3	[5]
Genistein	DM0JETC	Menopause symptom	GA30.0	Phase 2/3	[6]
AUS-131	DMUXO3Z	Hot flushes	GA30	Phase 2	[7]
ERB-041	DMCEPUA	Inflammatory bowel disease	DD72	Phase 2	[8]
Erteberel	DMU1XZD	Prostate hyperplasia	GA90	Phase 2	[9]
VG-101	DMAN21O	Menopause symptom	GA30.0	Phase 1/2	[10]
ERB-257	DMKMR2X	Sepsis	1G40-1G41	Phase 1	[11]
NARINGENIN	DMHAZLM	N. A.	N. A.	Phase 1	[12]

9 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BITHIONOL	DMPJKRL	Trematode infection	1F8Y	Withdrawn from market	[13]
HEXESTROL	DM9AGWQ	Irregularities	N.A.	Withdrawn from market	[14]
EM-800	DM5JUW0	Estrogen deficiency	FB83.0Y	Discontinued in Phase 3	[15]
ERA-923	DM6NTAS	Breast cancer	2C60-2C65	Discontinued in Phase 2	[16]
ERB-196	DMGX08C	Inflammatory bowel disease	DD72	Discontinued in Phase 1	[17]
HE2100	DMCP2KH	Thrombocytopenia	3B64	Discontinued in Phase 1	[18]
ICI-164384	DMYN3WG	Breast cancer	2C60-2C65	Terminated	[19]
LY-117018	DMUHG0F	N. A.	N. A.	Terminated	[20]
ZK-119010	DMKFYDE	Carcinoma	2A00-2F9Z	Terminated	[21]

161 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,2-Bis-(4-hydroxy-phenyl)-3H-inden-5-ol	DM9RF1T	Discovery agent	N.A.	Investigative	[22]
1,8-Dichloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DMKJBRZ	Discovery agent	N.A.	Investigative	[23]
1-Bromo-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DM2T4NL	Discovery agent	N.A.	Investigative	[23]
1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL	DM0MGFQ	Discovery agent	N.A.	Investigative	[24]
1-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DM8BC1M	Discovery agent	N.A.	Investigative	[23]
2,3-diphenyl-1H-indole	DMC3UYH	Discovery agent	N.A.	Investigative	[25]
2-(2-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol	DMWDV71	Discovery agent	N.A.	Investigative	[26]
2-(3-Butoxy-4-hydroxy-phenyl)-benzooxazol-6-ol	DMJM5VW	Discovery agent	N.A.	Investigative	[26]
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol	DMBONUV	Discovery agent	N.A.	Investigative	[26]
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-6-ol	DM3B6IN	Discovery agent	N.A.	Investigative	[26]
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-5-ol	DMNTHK5	Discovery agent	N.A.	Investigative	[26]
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-6-ol	DM50FW1	Discovery agent	N.A.	Investigative	[26]
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol	DMZCE18	Discovery agent	N.A.	Investigative	[27]
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-6-ol	DMIGXRJ	Discovery agent	N.A.	Investigative	[27]
2-(4-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol	DMUGHF6	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-1-p-tolyl-3H-inden-5-ol	DMBIV8F	Discovery agent	N.A.	Investigative	[22]
2-(4-Hydroxy-phenyl)-4-methoxy-quinolin-6-ol	DM4N0LB	Discovery agent	N.A.	Investigative	[28]
2-(4-Hydroxy-phenyl)-4-vinyl-quinolin-6-ol	DM81G2U	Discovery agent	N.A.	Investigative	[28]
2-(4-Hydroxy-phenyl)-7-isopropyl-benzooxazol-5-ol	DMFWOMY	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-7-methoxy-benzofuran-5-ol	DMY0I8P	Discovery agent	N.A.	Investigative	[29]
2-(4-Hydroxy-phenyl)-7-methoxy-benzooxazol-5-ol	DMCNITS	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-7-methyl-benzofuran-5-ol	DMQ2KPI	Discovery agent	N.A.	Investigative	[29]
2-(4-Hydroxy-phenyl)-7-phenyl-benzooxazol-5-ol	DMUB7KH	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-7-propenyl-benzooxazol-5-ol	DMND63Z	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-7-propyl-benzooxazol-5-ol	DMONT2D	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-7-vinyl-benzooxazol-5-ol	DM2F6U3	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-benzooxazol-5-ol	DMMUNA7	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-benzooxazol-6-ol	DM31MY0	Discovery agent	N.A.	Investigative	[26]
2-(4-Hydroxy-phenyl)-quinolin-6-ol	DMCWFUZ	Discovery agent	N.A.	Investigative	[28]
2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL	DMN6S3F	Discovery agent	N.A.	Investigative	[24]
2-(4-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol	DMW6L38	Discovery agent	N.A.	Investigative	[27]
2-(5-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol	DMB3JG0	Discovery agent	N.A.	Investigative	[26]
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-5-ol	DMXAVHT	Discovery agent	N.A.	Investigative	[26]
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol	DM3GQN2	Discovery agent	N.A.	Investigative	[26]
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-5-ol	DM715EC	Discovery agent	N.A.	Investigative	[26]
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-6-ol	DMANHOT	Discovery agent	N.A.	Investigative	[26]
2-Naphthalen-1-yl-benzooxazol-6-ol	DMBI6U9	Discovery agent	N.A.	Investigative	[26]
2-phenyl-1,2'-spirobi[1H-indene]-5'-ol	DMP8G3C	Discovery agent	N.A.	Investigative	[27]
3'-Methoxy-4'Hydroxyclomiphene	DMG1T6H	Discovery agent	N.A.	Investigative	[30]
3,4,6-Trihydroxy-2-(4-hydroxy-phenyl)-inden-1-one	DM3MAEQ	Discovery agent	N.A.	Investigative	[31]
3,6-Dihydroxy-2-(4-hydroxy-phenyl)-inden-1-one	DMUH4OV	Discovery agent	N.A.	Investigative	[31]
3,8-dihydroxy-4-methyl-6H-benzo[c]chromen-6-one	DMIFJRS	Discovery agent	N.A.	Investigative	[32]
3,8-dihydroxy-7-methyl-6H-benzo[c]chromen-6-one	DMW0B4H	Discovery agent	N.A.	Investigative	[32]
3-(2-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol	DMD24EW	Discovery agent	N.A.	Investigative	[26]
3-(4-Hydroxy-phenyl)-4H-chromen-7-ol	DMN01PI	Discovery agent	N.A.	Investigative	[33]
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-5-ol	DMXZ9T6	Discovery agent	N.A.	Investigative	[26]
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol	DMYLDFG	Discovery agent	N.A.	Investigative	[26]
3-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol	DMPRBLH	Discovery agent	N.A.	Investigative	[26]
3-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol	DM5H9QT	Discovery agent	N.A.	Investigative	[26]
3-chloro-4-(4-hydroxyphenyl)salicylaldoxime	DMER4U1	Discovery agent	N.A.	Investigative	[34]
3-hydroxy-4,10-dimethyl-6H-benzo[c]chromen-6-one	DMEJQTA	Discovery agent	N.A.	Investigative	[32]
3-hydroxy-4,7-dimethyl-6H-benzo[c]chromen-6-one	DMUME74	Discovery agent	N.A.	Investigative	[32]
3-hydroxy-4-methyl-6H-benzo[c]chromen-6-one	DMDBJCY	Discovery agent	N.A.	Investigative	[32]
3-hydroxy-8,10-dimethyl-6H-benzo[c]chromen-6-one	DM3H56L	Discovery agent	N.A.	Investigative	[32]
3-[1-ethyl-2-(3-hydroxyphenyl)butyl]phenol	DMPTI1Z	Discovery agent	N.A.	Investigative	[35]
4',5,7-trihydroxy-6,8-dimethylisoflavone	DM1RM3H	Discovery agent	N.A.	Investigative	[36]
4,10-dimethyl-6H-benzo[c]chromene-3,8-diol	DMB5RJK	Discovery agent	N.A.	Investigative	[32]
4,6,10-trimethyl-6H-benzo[c]chromene-3,8-diol	DM6N98E	Discovery agent	N.A.	Investigative	[32]
4,6,6,7-tetramethyl-6H-benzo[c]chromene-3,8-diol	DM14VI3	Discovery agent	N.A.	Investigative	[32]
4,6,7,10-tetramethyl-6H-benzo[c]chromene-3,8-diol	DMYN25U	Discovery agent	N.A.	Investigative	[32]
4,6,7-trimethyl-6H-benzo[c]chromene-3,8-diol	DMFECXI	Discovery agent	N.A.	Investigative	[32]
4,7-dimethyl-6H-benzo[c]chromene-3,8-diol	DM67Z81	Discovery agent	N.A.	Investigative	[32]
4-(2-phenyl-1H-benzo[d]imidazol-1-yl)phenol	DMFQZOI	Discovery agent	N.A.	Investigative	[25]
4-(2-phenyl-1H-indol-3-yl)phenol	DMCPSE9	Discovery agent	N.A.	Investigative	[25]
4-(3-(4-hydroxyphenyl)-1H-indol-2-yl)phenol	DMR3T2D	Discovery agent	N.A.	Investigative	[25]
4-(3-phenyl-1H-indol-2-yl)phenol	DMEJF6V	Discovery agent	N.A.	Investigative	[25]
4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME	DMZT6HL	Discovery agent	N.A.	Investigative	[24]
4-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol	DM1EANV	Discovery agent	N.A.	Investigative	[26]
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol	DM38YZ4	Discovery agent	N.A.	Investigative	[26]
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol	DM07NT9	Discovery agent	N.A.	Investigative	[26]
4-Benzo[d]isoxazol-3-yl-benzene-1,3-diol	DM1UG2A	Discovery agent	N.A.	Investigative	[26]
4-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMPSRAC	Discovery agent	N.A.	Investigative	[28]
4-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMKJ18X	Discovery agent	N.A.	Investigative	[28]
4-Ethyl-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMTIY89	Discovery agent	N.A.	Investigative	[28]
4-Ethynyl-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMXLZAT	Discovery agent	N.A.	Investigative	[28]
4-Naphthalen-2-yl-phenol	DMKPNSH	Discovery agent	N.A.	Investigative	[23]
4-[1,2-bis(4-hydroxyphenyl)but-1-enyl]phenol	DMW1IXY	Discovery agent	N.A.	Investigative	[37]
4-[1,2-bis(4-hydroxyphenyl)hex-1-enyl]phenol	DMTL6ES	Discovery agent	N.A.	Investigative	[37]
4-[1,2-bis(4-hydroxyphenyl)pent-1-enyl]phenol	DMTHG0Y	Discovery agent	N.A.	Investigative	[37]
4-[1,2-bis(4-hydroxyphenyl)vinyl]phenol	DMR7GP6	Discovery agent	N.A.	Investigative	[37]
4-[2,2-bis(4-hydroxyphenyl)-1-methylvinyl]phenol	DMS0HV6	Discovery agent	N.A.	Investigative	[37]
5,7-dihydroxy-3-phenyl-3H-quinazolin-4-one	DMA61I2	Discovery agent	N.A.	Investigative	[38]
5-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol	DM2YL0T	Discovery agent	N.A.	Investigative	[28]
5-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-6-ol	DMCFIZN	Discovery agent	N.A.	Investigative	[26]
5-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol	DMXNPSB	Discovery agent	N.A.	Investigative	[28]
6-(2,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMRU963	Discovery agent	N.A.	Investigative	[23]
6-(2,6-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMFALTY	Discovery agent	N.A.	Investigative	[23]
6-(2-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol	DMTPAMS	Discovery agent	N.A.	Investigative	[23]
6-(2-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DM6Q3M7	Discovery agent	N.A.	Investigative	[23]
6-(2-Hydroxy-phenyl)-naphthalen-2-ol	DMM3798	Discovery agent	N.A.	Investigative	[23]
6-(3,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMKJOL6	Discovery agent	N.A.	Investigative	[23]
6-(3-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol	DM4YP3Q	Discovery agent	N.A.	Investigative	[23]
6-(3-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol	DMAJEDG	Discovery agent	N.A.	Investigative	[23]
6-(3-Hydroxy-phenyl)-naphthalen-1-ol	DMMHRVO	Discovery agent	N.A.	Investigative	[23]
6-(3-Hydroxy-phenyl)-naphthalen-2-ol	DMH8WA2	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-2-methoxy-phenyl)-naphthalen-2-ol	DMYM3EW	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-2-methyl-phenyl)-naphthalen-2-ol	DMYEIRH	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-phenyl)-1-methoxy-naphthalen-2-ol	DMBG5Y8	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-phenyl)-1-methyl-naphthalen-2-ol	DMGLT0N	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-phenyl)-1-nitro-naphthalen-2-ol	DMGC84U	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-phenyl)-1-phenyl-naphthalen-2-ol	DMI6UVN	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-phenyl)-naphthalen-1-ol	DM2V9XI	Discovery agent	N.A.	Investigative	[23]
6-(4-Hydroxy-phenyl)-naphthalen-2-ol	DM3L2OI	Discovery agent	N.A.	Investigative	[28]
6-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMLMOC0	Discovery agent	N.A.	Investigative	[26]
6-ethyl-4,7-dimethyl-6H-benzo[c]chromene-3,8-diol	DMOGETD	Discovery agent	N.A.	Investigative	[32]
6-Phenyl-naphthalen-2-ol	DMEYOF7	Discovery agent	N.A.	Investigative	[23]
7-(3-Hydroxy-phenyl)-naphthalen-2-ol	DM2I91C	Discovery agent	N.A.	Investigative	[23]
7-(4-Hydroxy-phenyl)-naphthalen-2-ol	DMM9IXB	Discovery agent	N.A.	Investigative	[23]
7-Allyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMSRQ1L	Discovery agent	N.A.	Investigative	[26]
7-Bromo-2-(4-hydroxy-phenyl)-benzofuran-5-ol	DMA8DXG	Discovery agent	N.A.	Investigative	[29]
7-Butyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMQ8BIX	Discovery agent	N.A.	Investigative	[26]
7-Chloro-2-(4-hydroxy-phenyl)-benzofuran-5-ol	DM38HKE	Discovery agent	N.A.	Investigative	[29]
7-Ethyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DMUMN4B	Discovery agent	N.A.	Investigative	[26]
7-Ethynyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol	DM92EG5	Discovery agent	N.A.	Investigative	[26]
7-hydroxy-1,2,9,9a-tetrahydrofluoren-3-one	DMKSJE3	Discovery agent	N.A.	Investigative	[39]
7-hydroxy-3-(4-hydroxyphenyl)-3H-quinazolin-4-one	DM46J2H	Discovery agent	N.A.	Investigative	[38]
7-Phenyl-naphthalen-2-ol	DM1WJFR	Discovery agent	N.A.	Investigative	[23]
8-(2,2-dimethylpropyl)naringenin	DMV5FZO	Discovery agent	N.A.	Investigative	[12]
8-(2-methylpropyl)naringenin	DMQUZSJ	Discovery agent	N.A.	Investigative	[12]
8-(3-methylbutyl)naringenin	DM2VAJE	Discovery agent	N.A.	Investigative	[12]
8-benzylnaringenin	DMKHF87	Discovery agent	N.A.	Investigative	[12]
8-Chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DMB76ZN	Discovery agent	N.A.	Investigative	[23]
8-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol	DMGJ3L6	Discovery agent	N.A.	Investigative	[23]
8-methylnaringenin	DMK63P2	Discovery agent	N.A.	Investigative	[12]
8-n-heptylnaringenin	DMWMVI3	Discovery agent	N.A.	Investigative	[12]
8-n-nonylnaringenin	DMC2JLQ	Discovery agent	N.A.	Investigative	[12]
8-n-pentylnaringenin	DMRDOP0	Discovery agent	N.A.	Investigative	[12]
8-n-propylnaringenin	DMDOW5S	Discovery agent	N.A.	Investigative	[12]
8-n-undecylnaringenin	DMXURM8	Discovery agent	N.A.	Investigative	[12]
Acetate Ion	DMD08RH	Discovery agent	N.A.	Investigative	[40]
bisphenol A	DM2ZLD7	Discovery agent	N.A.	Investigative	[41]
BROUSSONIN A	DMXFN6H	Discovery agent	N.A.	Investigative	[42]
COUMESTROL	DM40TBU	Discovery agent	N.A.	Investigative	[33]
CP-394531	DMDPH3W	Discovery agent	N.A.	Investigative	[43]
CP-409069	DM1U6P7	Discovery agent	N.A.	Investigative	[43]
daidzein	DMRFTJX	Discovery agent	N.A.	Investigative	[36]
diarylpropionitril	DM14X29	Discovery agent	N.A.	Investigative	[44]
DIHYDRORALOXIFENE	DM70OIC	Discovery agent	N.A.	Investigative	[45]
Doxorubicin-Formaldehyde Conjugate	DMJF6AQ	Discovery agent	N.A.	Investigative	[46]
EFFUSOL	DMXZRND	Discovery agent	N.A.	Investigative	[32]
ERB-002	DMYRDBX	Inflammation	1A00-CA43.1	Investigative	[47]
Geldanamycin-estradiol hybrid	DMUSJ96	Discovery agent	N.A.	Investigative	[48]
GNF-PF-3037	DM4RZSB	Discovery agent	N.A.	Investigative	[13]
GTx-822	DMEIMVW	Ocular disease	1F00.1Z	Investigative	[47]
GTx-878	DMP9OGC	Prostate hyperplasia	GA90	Investigative	[47]
HPTE	DMRPZD4	Discovery agent	N.A.	Investigative	[49]
KB-9520	DMCQRA3	Solid tumour/cancer	2A00-2F9Z	Investigative	[47]
MORIN	DM2OGZ5	Discovery agent	N.A.	Investigative	[13]
Nafoxidine	DM0FROP	Discovery agent	N.A.	Investigative	[50]
NDC-1022	DM7NJI2	Solid tumour/cancer	2A00-2F9Z	Investigative	[47]
Para-Mercury-Benzenesulfonic Acid	DMQVFWJ	Discovery agent	N.A.	Investigative	[40]
PHTPP	DMBHKAV	Discovery agent	N.A.	Investigative	[51]
R,R-THC	DM4URMA	Discovery agent	N.A.	Investigative	[52]
SOPHORAFLAVANONE B	DMUVKX5	Discovery agent	N.A.	Investigative	[12]
THIOGENISTEIN	DMK2J5L	Discovery agent	N.A.	Investigative	[38]
Trans-hydroxytamoxifen	DMXS8LN	Discovery agent	N.A.	Investigative	[53]
TUPICHINOL C	DMAUTRP	Discovery agent	N.A.	Investigative	[42]
WAY-169916	DM94KWA	Discovery agent	N.A.	Investigative	[54]
WAY200070	DMBHXTL	Discovery agent	N.A.	Investigative	[26]
ZK-164015	DMROWV8	Discovery agent	N.A.	Investigative	[55]
[1,1':2',1'']Terphenyl-4'-carbaldehyde oxime	DMFXA8P	Discovery agent	N.A.	Investigative	[56]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Neonatal sepsis	1G41	Whole blood	6.89E-01	0.03	0.14
Prostate cancer	2C82	Prostate	2.09E-01	-0.06	-0.17
Breast cancer	2C82	Breast tissue	1.12E-20	-0.22	-0.7

References

• [1] Differential biochemical and cellular actions of Premarin estrogens: distinct pharmacology of bazedoxifene-conjugated estrogens combination. Mol Endocrinol. 2009 Jan;23(1):74-85.
• [2] Benzothiophene selective estrogen receptor modulators with modulated oxidative activity and receptor affinity. J Med Chem. 2007 May 31;50(11):2682-92.
• [3] Estrogen inhibits the vascular injury response in estrogen receptor beta-deficient female mice. Proc Natl Acad Sci U S A. 1999 Dec 21;96(26):15133-6.
• [4] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [5] MF101, a selective estrogen receptor beta modulator for the treatment of menopausal hot flushes: a phase II clinical trial. Menopause. 2009 May-Jun;16(3):458-65.
• [6] Company report (Axcentua)
• [7] S-equol, a potent ligand for estrogen receptor beta, is the exclusive enantiomeric form of the soy isoflavone metabolite produced by human intestinal bacterial flora. Am J Clin Nutr. 2005 May;81(5):1072-9.
• [8] Erb-041, an estrogen receptor-beta agonist, inhibits skin photocarcinogenesis in SKH-1 hairless mice by downregulating the WNT signaling pathway. Cancer Prev Res (Phila). 2014 Feb;7(2):186-98.
• [9] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031986)
• [10] Update on alternative therapies for vulvovaginal atrophy. Patient Prefer Adherence. 2011; 5: 533-536.
• [11] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030075)
• [12] Subtle side-chain modifications of the hop phytoestrogen 8-prenylnaringenin result in distinct agonist/antagonist activity profiles for estrogen re... J Med Chem. 2006 Dec 14;49(25):7357-65.
• [13] In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6.
• [14] Bone targeted drugs 2. synthesis of estrogens with hydroxyapatite affinity, Bioorg. Med. Chem. Lett. 6(9):1047-1050 (1996).
• [15] EM-800, a novel antiestrogen, acts as a pure antagonist of the transcriptional functions of estrogen receptors alpha and beta. Endocrinology. 1998 Jan;139(1):111-8.
• [16] Design, synthesis, and preclinical characterization of novel, highly selective indole estrogens. J Med Chem. 2001 May 24;44(11):1654-7.
• [17] WAY-202196, a selective estrogen receptor-beta agonist, protects against death in experimental septic shock. Crit Care Med. 2006 Aug;34(8):2188-93.
• [18] Androstene-3,5-dienes as ER-beta selective SERMs. Bioorg Med Chem Lett. 2007 Nov 15;17(22):6295-8.
• [19] Synthesis and biological activity of new halo-steroidal antiestrogens. J Med Chem. 1991 May;34(5):1624-30.
• [20] Structure-activity relationship of antiestrogens. Phenolic analogues of 2,3-diaryl-2H-1-benzopyrans. J Med Chem. 1990 Dec;33(12):3222-9.
• [21] 2-Phenylindole-linked [2-(aminoalkyl)pyridine]dichloroplatinum(II): complexes with a selective action on estrogen receptor positive mammary tumors. J Med Chem. 1991 Jul;34(7):2145-52.
• [22] Differential response of estrogen receptor subtypes to 1,3-diarylindene and 2,3-diarylindene ligands. J Med Chem. 2005 Sep 22;48(19):5989-6003.
• [23] ERbeta ligands. 3. Exploiting two binding orientations of the 2-phenylnaphthalene scaffold to achieve ERbeta selectivity. J Med Chem. 2005 Jun 16;48(12):3953-79.
• [24] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [25] Estrogen receptor beta selective ligands: discovery and SAR of novel heterocyclic ligands. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5562-6.
• [26] Design and synthesis of aryl diphenolic azoles as potent and selective estrogen receptor-beta ligands. J Med Chem. 2004 Oct 7;47(21):5021-40.
• [27] 2-Phenylspiroindenes: a novel class of selective estrogen receptor modulators (SERMs). Bioorg Med Chem Lett. 2003 Feb 10;13(3):479-83.
• [28] ERbeta ligands. Part 4: Synthesis and structure-activity relationships of a series of 2-phenylquinoline derivatives. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4520-5.
• [29] 7-Substituted 2-phenyl-benzofurans as ER beta selective ligands. Bioorg Med Chem Lett. 2004 Oct 4;14(19):4925-9.
• [30] Phenolic metabolites of clomiphene: [(E,Z)-2-[4-(1,2-diphenyl-2-chlorovinyl)phenoxy]ethyl]diethylamine. Preparation, electrophilicity, and effects ... J Med Chem. 1989 Jan;32(1):192-7.
• [31] Estrogen receptor ligands: design and synthesis of new 2-arylindene-1-ones. Bioorg Med Chem Lett. 2005 Jun 15;15(12):3137-42.
• [32] 6H-Benzo[c]chromen-6-one derivatives as selective ERbeta agonists. Bioorg Med Chem Lett. 2006 Mar 15;16(6):1468-72.
• [33] Structure-based virtual screening for plant-based ERbeta-selective ligands as potential preventative therapy against age-related neurodegenerative ... J Med Chem. 2005 May 19;48(10):3463-6.
• [34] Monoaryl-substituted salicylaldoximes as ligands for estrogen receptor beta. J Med Chem. 2008 Mar 13;51(5):1344-51.
• [35] Influence of alkyl chain ramification on estradiol receptor binding affinity and intrinsic activity of 1,2-dialkylated 1,2-bis(4- or 3-hydroxypheny... J Med Chem. 1986 Sep;29(9):1668-74.
• [36] Isolation and structure elucidation of an isoflavone and a sesterterpenoic acid from Henriettella fascicularis. J Nat Prod. 2002 Dec;65(12):1749-53.
• [37] Antiestrogenically active 1,1,2-tris(4-hydroxyphenyl)alkenes without basic side chain: synthesis and biological activity. J Med Chem. 2003 Apr 10;46(8):1484-91.
• [38] Synthesis and characterization of 3-arylquinazolinone and 3-arylquinazolinethione derivatives as selective estrogen receptor beta modulators. J Med Chem. 2006 Apr 20;49(8):2440-55.
• [39] The discovery of tetrahydrofluorenones as a new class of estrogen receptor beta-subtype selective ligands. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3489-94.
• [40] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [41] Structure-activity relationships of bisphenol A analogs at estrogen receptors (ERs): discovery of an ERalpha-selective antagonist. Bioorg Med Chem Lett. 2013 Jul 15;23(14):4031-6.
• [42] New estrogenic compounds isolated from Broussonetia kazinoki. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3764-7.
• [43] Discovery of potent, nonsteroidal, and highly selective glucocorticoid receptor antagonists. J Med Chem. 2002 Jun 6;45(12):2417-24.
• [44] Estrogen receptor-beta potency-selective ligands: structure-activity relationship studies of diarylpropionitriles and their acetylene and polar analogues. J Med Chem. 2001 Nov 22;44(24):4230-51.
• [45] Synthesis and biological activity of trans-2,3-dihydroraloxifene. Bioorg Med Chem Lett. 1999 Apr 19;9(8):1137-40.
• [46] Design, synthesis, and biological evaluation of doxorubicin-formaldehyde conjugates targeted to breast cancer cells. J Med Chem. 2004 Feb 26;47(5):1193-206.
• [47] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 621).
• [48] Synthesis and evaluation of geldanamycin-estradiol hybrids. Bioorg Med Chem Lett. 1999 May 3;9(9):1233-8.
• [49] Signalling by CXC-chemokine receptors 1 and 2 expressed in CHO cells: a comparison of calcium mobilization, inhibition of adenylyl cyclase and stimulation of GTPgammaS binding induced by IL-8 and GROalpha. Br J Pharmacol. 1999 Feb;126(3):810-8.
• [50] Discovery and preclinical pharmacology of a novel, potent, nonsteroidal estrogen receptor agonist/antagonist, CP-336156, a diaryltetrahydronaphthal... J Med Chem. 1998 Jul 30;41(16):2928-31.
• [51] Structure-guided optimization of estrogen receptor binding affinity and antagonist potency of pyrazolopyrimidines with basic side chains. J Med Chem. 2007 Jan 25;50(2):399-403.
• [52] Estrogen receptor subtype-selective ligands: asymmetric synthesis and biological evaluation of cis- and trans-5,11-dialkyl- 5,6,11, 12-tetrahydrochrysenes. J Med Chem. 1999 Jul 1;42(13):2456-68.
• [53] Antagonists selective for estrogen receptor alpha. Endocrinology. 2002 Mar;143(3):941-7.
• [54] Synthesis and activity of substituted 4-(indazol-3-yl)phenols as pathway-selective estrogen receptor ligands useful in the treatment of rheumatoid ... J Med Chem. 2004 Dec 16;47(26):6435-8.
• [55] Synthesis and biological evaluation of stilbene-based pure estrogen antagonists. Bioorg Med Chem Lett. 2004 Sep 20;14(18):4659-63.
• [56] Novel estrogen receptor ligands based on an anthranylaldoxime structure: role of the phenol-type pseudocycle in the binding process. J Med Chem. 2003 Sep 11;46(19):4032-42.