Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTSQIFT)

• DTT Name: 5-HT 1A receptor (HTR1A)
• Synonyms: Serotonin receptor 1A; G-21; ADRBRL1; ADRB2RL1; 5-hydroxytryptamine receptor 1A; 5-HT1A receptor; 5-HT1A; 5-HT-1A
• Gene Name: HTR1A
• DTT Type: Successful target; [1]
• Related Disease:
  Anxiety disorder [ICD-11: 6B00-6B0Z]
  Depression [ICD-11: 6A70-6A7Z]
  Hypertension [ICD-11: BA00-BA04]
  Migraine [ICD-11: 8A80]
  Mood disorder [ICD-11: 6A60-6E23]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: 5HT1A_HUMAN
• TTD ID: T78709
• Sequence:
  MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
  IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
  TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
  RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
  RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
  SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
  FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
  RQ
• Function: Functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli. G-protein coupled receptor for 5-hydroxytryptamine (serotonin).
• KEGG Pathway:
  cAMP signaling pathway (hsa04024)
  Neuroactive ligand-receptor interaction (hsa04080)
  Serotonergic synapse (hsa04726)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Serotonin receptors (R-HSA-390666)

Molecular Interaction Atlas (MIA) of This DTT

8 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Buspirone	DMBS632	Anxiety disorder	6B00-6B0Z	Approved	[1]
Flibanserin	DM70DTN	Mood disorder	6A60-6E23	Approved	[2]
OPC-34712	DMHG57U	Major depressive disorder	6A70.3	Approved	[3], [4]
Tertatolol	DM2L3D5	Hypertension	BA00-BA04	Approved	[5]
Trazodone	DMK1GBJ	Depression	6A70-6A7Z	Approved	[6]
Treximet	DMU54QB	Migraine	8A80	Approved	[7]
Urapidil	DMD59GI	Hypertension	BA00-BA04	Approved	[8]
Vilazodone	DM4LECQ	Major depressive disorder	6A70.3	Approved	[9]

33 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CM-2395	DMASPWR	Schizophrenia	6A20	Phase 3	[10]
Eltoprazine	DMW6C81	Attention deficit hyperactivity disorder	6A05.Z	Phase 3	[11]
SEP-363856	DMG2QP4	Schizophrenia	6A20	Phase 3	[12]
Xaliproden	DM1JCW8	Juvenile idiopathic arthritis	FA24	Phase 3	[13]
LECOZOTAN HYDROCHLORIDE	DMBJ4IZ	Cognitive impairment	6D71	Phase 2/3	[14], [15]
Sarizotan	DMH7IPW	Rett syndrome	LD90.4	Phase 2/3	[16]
Ensaculin hydrochloride	DMLPRZJ	Parkinson disease	8A00.0	Phase 2	[17], [18]
FKB01MD	DM2O7NM	N. A.	N. A.	Phase 2	[19]
FKW00GA	DMPXH7N	Social phobia	6B04	Phase 2	[19]
Mazapertine succinate	DMJKHVX	Psychotic disorder	6A20-6A25	Phase 2	[16]
MIN-117	DMSLIW6	Major depressive disorder	6A70.3	Phase 2	[20]
MN-305	DMUGN4B	Mood disorder	6A60-6E23	Phase 2	[21]
Neu-P11	DMIQDFW	Alzheimer disease	8A20	Phase 2	[22]
OPC-14523	DMB1WF3	Bulimia nervosa	6B81	Phase 2	[23]
ORG-13011	DMAWXJT	Anxiety disorder	6B00-6B0Z	Phase 2	[24], [15]
RP5063	DMKUE8O	Schizophrenia	6A20	Phase 2	[25], [26]
S-15535	DMKTLSD	Anxiety disorder	6B00-6B0Z	Phase 2	[27], [15], [28]
S-16924	DML2D30	Anxiety disorder	6B00-6B0Z	Phase 2	[29], [30]
SDZ-MAR-327	DM2YIOE	Psychotic disorder	6A20-6A25	Phase 2	[31]
SUN N4057	DMO9LBE	Coronary artery disease	BA80	Phase 2	[32]
TGBA01AD	DMJ2FTU	Mood disorder	6A60-6E23	Phase 2	[33]
TGFK08AA	DMNXJ5B	Generalized anxiety disorder	6B00	Phase 2	[34]
TGFK09SD	DMGWE4H	Hypoactive sexual desire dysfunction	HA00	Phase 2	[35]
TGWOOAA	DMI57ZA	Generalized anxiety disorder	6B00	Phase 2	[36]
Zalospirone	DMJN3BA	Anxiety disorder	6B00-6B0Z	Phase 2	[37]
1192U90	DM5IPHE	Psychotic disorder	6A20-6A25	Phase 1	[38]
AV-965	DMVL87N	Alzheimer disease	8A20	Phase 1	[39]
DSP-1053	DMJDP0E	Major depressive disorder	6A70.3	Phase 1	[40]
GSK-958108	DM4LR0Y	Premature ejaculation	HA03.0Z	Phase 1	[41]
NLX-101	DMPJMB7	Rett syndrome	LD90.4	Phase 1	[42]
SKL-PSY	DM8YNI6	Bipolar disorder	6A60	Phase 1	[43]
SSR-181507	DMXQF1T	Schizophrenia	6A20	Phase 1	[44]
Umespirone	DMTLNGV	Anxiety disorder	6B00-6B0Z	Phase 1	[45]

10 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aryl piperazine derivative 1	DM9DJGU	N. A.	N. A.	Patented	[46]
Aryl piperazine derivative 14	DMY8NEL	N. A.	N. A.	Patented	[46]
Aryl piperazine derivative 15	DMRK4IE	N. A.	N. A.	Patented	[46]
Aryl piperazine derivative 16	DM63XHT	N. A.	N. A.	Patented	[46]
Aryl piperazine derivative 6	DMZ3DS5	N. A.	N. A.	Patented	[46]
PMID30124346-Compound-13TABLE4	DMHTJVA	Attention deficit hyperactivity disorder	6A05.Z	Patented	[46]
PMID30124346-Compound-34TABLE4	DM2G3VE	Attention deficit hyperactivity disorder	6A05.Z	Patented	[46]
PMID30124346-Compound-60TABLE5	DM3QX0R	Dyskinesia	MB47.4	Patented	[46]
PMID30124346-Compound-LDT66	DMJMTNL	Benign prostatic hyperplasia	GA90	Patented	[46]
PMID30124346-Compound-LDT8	DM5MUNG	Benign prostatic hyperplasia	GA90	Patented	[46]

45 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LYSERGIC ACID DIETHYLAMIDE	DMACMLO	Addictive disorder	6C50-6C5Z	Withdrawn from market	[47]
Bifeprunox	DMOQIMS	Schizophrenia	6A20	Discontinued in Phase 3	[48]
BMS-181100	DM0HR5W	Psychotic disorder	6A20-6A25	Discontinued in Phase 3	[49], [50]
Flesinoxan	DMOIP7R	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[51]
Sunepitron	DM6M8ZX	N. A.	N. A.	Discontinued in Phase 3	[52]
TIOSPIRONE	DME5QDP	N. A.	N. A.	Discontinued in Phase 3	[53]
Adatanserin	DMMKFUP	Mood disorder	6A60-6E23	Discontinued in Phase 2	[21], [54]
ALNESPIRONE	DMT5KBF	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[55], [15]
AP-521	DMWDCG7	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[56], [15]
DU 125530	DM63UA9	Mood disorder	6A60-6E23	Discontinued in Phase 2	[57]
GSK163090	DMX7DVH	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[7]
LESOPITRON DIHYDROCHLORIDE	DMGQJ2U	Mood disorder	6A60-6E23	Discontinued in Phase 2	[58]
MAZAPERTINE	DMRHYAU	N. A.	N. A.	Discontinued in Phase 2	[59]
PRX-00023	DMN4RV0	Mood disorder	6A60-6E23	Discontinued in Phase 2	[60]
REC-15/3079	DMIEFH0	Urinary incontinence	MF50.2	Discontinued in Phase 2	[61]
Robalzotan	DMZAISC	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[62]
BINOSPIRONE MESYLATE	DM3HRQI	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[63], [15]
DU-29894	DMN9KXU	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[64]
E2101	DMI9NZ3	Cervical dystonia	8A02.0Y	Discontinued in Phase 1	[65]
Ebalzotan	DMSOH09	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[66]
Eptapirone	DMFGTMR	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[67]
GR-127607	DMRNI6K	Migraine	8A80	Discontinued in Phase 1	[68]
Nerisopam	DMK5VB2	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[69]
SLV-313	DMJFWB7	Schizophrenia	6A20	Discontinued in Phase 1	[70]
SUN-8399	DMBCQFH	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[71]
U-93385	DMMSWJ3	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 1	[72], [15]
A-74283	DMS3R15	Hypertension	BA00-BA04	Terminated	[74]
A-80426	DMBC3DG	N. A.	N. A.	Terminated	[75]
Anpirtoline	DM35LJC	Pain	MG30-MG3Z	Terminated	[76]
BMY-7378	DMRHCEG	N. A.	N. A.	Terminated	[77]
BTS-79018	DMAH3Z9	Schizophrenia	6A20	Terminated	[38]
CGS-18102A	DM4W3MU	Anxiety disorder	6B00-6B0Z	Terminated	[78]
CP-293019	DMDQBAL	N. A.	N. A.	Terminated	[79]
Du-123015	DMX5SN8	Anxiety disorder	6B00-6B0Z	Terminated	[80]
Gepirone	DMGX5Q0	Depression	6A70-6A7Z	Terminated	[21]
HT-90B	DMQINWF	Anxiety disorder	6B00-6B0Z	Terminated	[81]
Ipsapirone	DMEJU1L	Anxiety disorder	6B00-6B0Z	Terminated	[82]
LY-293284	DMH21JG	Anxiety disorder	6B00-6B0Z	Terminated	[83]
NAN-190	DMML3J4	N. A.	N. A.	Terminated	[84]
RWJ-25730	DMRQZWN	Psychotic disorder	6A20-6A25	Terminated	[85]
S-14506	DM05IQU	Anxiety disorder	6B00-6B0Z	Terminated	[86]
SDZ 216-525	DMPUVFH	N. A.	N. A.	Terminated	[84]
SLV-307	DMCPDBS	Parkinson disease	8A00.0	Terminated	[87]
WAY-100635	DMG58FX	Eating disorder	6B82	Terminated	[88], [57], [89], [90]
WB-4101	DMQU8B1	N. A.	N. A.	Terminated	[91]

2 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CM-2236	DMP9EJ7	Post-traumatic stress disorder	6B40	Preclinical	[73]
PD-158771	DM682UV	Schizophrenia	6A20	Preclinical	[38]

176 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(3-Chloro-phenyl)-piperazin-1-yl-methanone	DM7U02R	Discovery agent	N.A.	Investigative	[92]
(R)-(-)-10-methyl-11-hydroxyaporphine	DMYJAM5	Discovery agent	N.A.	Investigative	[93]
(R)-11-Amino-2-methoxyaporphine	DMKJWMC	Discovery agent	N.A.	Investigative	[94]
(R)-2,11-Diaminoaporphine	DM70ZIF	Discovery agent	N.A.	Investigative	[94]
(R)-flurocarazolol	DM2KBOU	Discovery agent	N.A.	Investigative	[95]
(S)-flurocarazolol	DM715AS	Discovery agent	N.A.	Investigative	[95]
1,2,3,4-Tetrahydro-naphthalen-2-ylamine	DMP4DLV	Discovery agent	N.A.	Investigative	[96]
1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane	DMDFU6S	Discovery agent	N.A.	Investigative	[97]
1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane	DMNLUKS	Discovery agent	N.A.	Investigative	[97]
1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane	DM0GRMD	Discovery agent	N.A.	Investigative	[97]
1,6-bis(4-m-tolylpiperazin-1-yl)hexane	DM5Z6XG	Discovery agent	N.A.	Investigative	[97]
1,6-bis(4-phenylpiperazin-1-yl)hexane	DMD3EUI	Discovery agent	N.A.	Investigative	[97]
1-((S)-2-aminopropyl)-1H-indazol-6-ol	DMU83KP	Discovery agent	N.A.	Investigative	[98]
1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine	DM31CVR	Discovery agent	N.A.	Investigative	[92]
1-(2,5-Dimethoxy-phenyl)-piperazine	DMNETHQ	Discovery agent	N.A.	Investigative	[92]
1-(2,5-dimethoxyphenyl)propan-2-amine	DM043N8	Discovery agent	N.A.	Investigative	[99]
1-(2-((3-fluorophenoxy)methyl)phenyl)piperazine	DMJXKOF	Discovery agent	N.A.	Investigative	[100]
1-(2-(2-chlorophenoxy)pyridin-3-yl)piperazine	DM9CVX5	Discovery agent	N.A.	Investigative	[101]
1-(2-(2-fluorobenzyloxy)phenyl)piperazine	DM6XCPV	Discovery agent	N.A.	Investigative	[100]
1-(2-(3-fluorophenoxy)phenyl)piperazine	DMXV2KQ	Discovery agent	N.A.	Investigative	[100]
1-(2-(4-fluorophenoxy)phenyl)piperazine	DMU082P	Discovery agent	N.A.	Investigative	[100]
1-(2-(benzyloxy)phenyl)piperazine	DM0UZHL	Discovery agent	N.A.	Investigative	[100]
1-(2-(phenoxymethyl)phenyl)piperazine	DM7Z19T	Discovery agent	N.A.	Investigative	[100]
1-(2-Butoxy-phenyl)-piperazine	DMT5S2O	Discovery agent	N.A.	Investigative	[102]
1-(2-Chloro-phenyl)-piperazine	DM5RE71	Discovery agent	N.A.	Investigative	[103]
1-(2-Ethoxy-phenyl)-piperazine	DM2P7YX	Discovery agent	N.A.	Investigative	[102]
1-(2-Fluoro-phenyl)-piperazine	DM94LID	Discovery agent	N.A.	Investigative	[102]
1-(2-Isopropoxy-phenyl)-piperazine	DM5KAH6	Discovery agent	N.A.	Investigative	[102]
1-(2-Methoxy-phenyl)-4-propyl-piperazine	DMCADRI	Discovery agent	N.A.	Investigative	[104]
1-(2-Methoxy-phenyl)-piperazine	DM3M4RA	Discovery agent	N.A.	Investigative	[103]
1-(2-methoxyphenyl)-4-pentylpiperazine	DM0EZSR	Discovery agent	N.A.	Investigative	[105]
1-(2-phenoxyphenyl)piperazine	DMWFCYN	Discovery agent	N.A.	Investigative	[100]
1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine	DMX5N3V	Discovery agent	N.A.	Investigative	[106]
1-(3-Fluoro-phenyl)-piperazine	DM2SNR0	Discovery agent	N.A.	Investigative	[102]
1-(3-Nitro-phenyl)-piperazine	DMMJC5E	Discovery agent	N.A.	Investigative	[102]
1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine	DMCH6R1	Discovery agent	N.A.	Investigative	[92]
1-(7-Methoxy-naphthalen-2-yl)-piperazine	DM1MJCE	Discovery agent	N.A.	Investigative	[107]
1-(benzyloxy)-2-(2-phenylethyl)benzene	DMVSC3O	Discovery agent	N.A.	Investigative	[108]
1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene	DMVB7P3	Discovery agent	N.A.	Investigative	[108]
1-Benzyl-4-chroman-2-ylmethyl-piperazine	DMAQSBV	Discovery agent	N.A.	Investigative	[109]
1-Butyl-4-(2-methoxy-phenyl)-piperazine	DM6QULO	Discovery agent	N.A.	Investigative	[104]
1-Ethyl-4-(2-methoxy-phenyl)-piperazine	DMGKP9Y	Discovery agent	N.A.	Investigative	[104]
1-Methyl-1,3-dihydro-indol-2-one	DMMX7V8	Discovery agent	N.A.	Investigative	[110]
1-Naphthalen-2-yl-piperazine	DMJK0MF	Discovery agent	N.A.	Investigative	[96]
1-naphthylpiperazine	DM6BIWK	Discovery agent	N.A.	Investigative	[107], [96]
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine	DMOCAUL	Discovery agent	N.A.	Investigative	[111]
1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene	DM3UHDW	Discovery agent	N.A.	Investigative	[108]
2-(2'-methyl-biphenyl-3-yl)-ethylamine	DM7HN4Z	Discovery agent	N.A.	Investigative	[112]
2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol	DMZNRFG	Discovery agent	N.A.	Investigative	[99]
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine	DM1ULEX	Discovery agent	N.A.	Investigative	[101]
2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine	DM1SN37	Discovery agent	N.A.	Investigative	[101]
2-(2-Methoxy-phenyl)-1-methyl-ethylamine	DMDI98B	Discovery agent	N.A.	Investigative	[99]
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine	DMYVDJQ	Discovery agent	N.A.	Investigative	[101]
2-(3-Bromophenylthio)-N,N-dimethylethanamine	DMFETRH	Discovery agent	N.A.	Investigative	[113]
2-(3-Methoxy-phenyl)-1-methyl-ethylamine	DM4C9H2	Discovery agent	N.A.	Investigative	[99]
2-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one	DMID9YA	Discovery agent	N.A.	Investigative	[109]
2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine	DM79JVK	Discovery agent	N.A.	Investigative	[99]
2-(4-Bromo-phenyl)-1-methyl-ethylamine	DMB49UP	Discovery agent	N.A.	Investigative	[99]
2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine	DMDHFU9	Discovery agent	N.A.	Investigative	[114]
2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine	DM1O0JD	Discovery agent	N.A.	Investigative	[115]
2-(Biphenyl-3-ylthio)-N,N-dimethylethanamine	DMU0GDY	Discovery agent	N.A.	Investigative	[113]
2-Dipropylamino-1,2,3,4-tetrahydro-anthracen-9-ol	DMF50YH	Discovery agent	N.A.	Investigative	[5]
2-phenoxy-3-(piperidin-4-yl)pyridine	DM6JNT5	Discovery agent	N.A.	Investigative	[101]
2-Piperazin-1-yl-benzonitrile	DM742IJ	Discovery agent	N.A.	Investigative	[102]
2-Piperazin-1-yl-phenol	DMQT9OK	Discovery agent	N.A.	Investigative	[92]
2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine	DM1PSRQ	Discovery agent	N.A.	Investigative	[108]
3-(1,2,3,6-Tetrahydro-pyridin-4-yl)-1H-indole	DMTDB62	Discovery agent	N.A.	Investigative	[116]
3-(1-Propyl-pyrrolidin-3-yl)-phenol	DM4QRV9	Discovery agent	N.A.	Investigative	[111]
3-(2-Amino-propyl)-1H-indol-5-ol	DMQPNUM	Discovery agent	N.A.	Investigative	[115]
3-(2-Benzylamino-ethoxy)-phenol	DMZCTGF	Discovery agent	N.A.	Investigative	[117]
3-(3-Methanesulfonyl-phenyl)-1-propyl-pyrrolidine	DMRDS1U	Discovery agent	N.A.	Investigative	[111]
3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one	DMFVCOP	Discovery agent	N.A.	Investigative	[109]
3-(4-Benzyl-piperidin-1-ylmethyl)-chromen-4-one	DM7LMD6	Discovery agent	N.A.	Investigative	[109]
3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine	DM2ETXB	Discovery agent	N.A.	Investigative	[101]
3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one	DMKGIQ1	Discovery agent	N.A.	Investigative	[92]
3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol	DMDOPVM	Discovery agent	N.A.	Investigative	[118]
3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol	DMN8C93	Discovery agent	N.A.	Investigative	[118]
3-Naphthalen-1-yl-1-propyl-pyrrolidine	DMNZI9R	Discovery agent	N.A.	Investigative	[111]
3-Naphthalen-1-yl-pyrrolidine	DMCW7F5	Discovery agent	N.A.	Investigative	[111]
3-Phenyl-1-propyl-pyrrolidine	DMJ0SVB	Discovery agent	N.A.	Investigative	[111]
3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine	DMLZ5F1	Discovery agent	N.A.	Investigative	[108]
4-(1H-indol-4-yloxy)-1-(isopropylamino)butan-2-ol	DMQVOSU	Discovery agent	N.A.	Investigative	[119]
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine	DM9UA0N	Discovery agent	N.A.	Investigative	[100]
4-(2-(2-fluorobenzyloxy)phenyl)piperidine	DMCR3VM	Discovery agent	N.A.	Investigative	[100]
4-(2-(3-chlorophenoxy)phenyl)piperidine	DM0IT5E	Discovery agent	N.A.	Investigative	[100]
4-(2-(3-fluorophenoxy)phenyl)piperidine	DMZMEOG	Discovery agent	N.A.	Investigative	[100]
4-(2-(4-fluorobenzyloxy)phenyl)piperidine	DM29QLG	Discovery agent	N.A.	Investigative	[100]
4-(2-(4-fluorophenoxy)phenyl)piperidine	DMFQT9O	Discovery agent	N.A.	Investigative	[100]
4-(2-(benzyloxy)-3-fluorophenyl)piperidine	DMM2NHZ	Discovery agent	N.A.	Investigative	[100]
4-(2-(benzyloxy)-6-fluorophenyl)piperidine	DMF3S50	Discovery agent	N.A.	Investigative	[100]
4-(2-(benzyloxy)phenyl)piperidine	DMOC7PY	Discovery agent	N.A.	Investigative	[100]
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine	DMQUAP2	Discovery agent	N.A.	Investigative	[101]
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine	DMUBHRF	Discovery agent	N.A.	Investigative	[100]
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine	DMJ2GW0	Discovery agent	N.A.	Investigative	[100]
4-(2-fluoro-6-phenoxyphenyl)piperidine	DMXIGWC	Discovery agent	N.A.	Investigative	[100]
4-(2-phenoxyphenyl)piperidine	DMB5IFA	Discovery agent	N.A.	Investigative	[100]
4-(3-fluoro-2-phenoxyphenyl)piperidine	DM1C3NZ	Discovery agent	N.A.	Investigative	[100]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[120]
4-Benzyl-1-chroman-2-ylmethyl-piperidine	DM6XLZ0	Discovery agent	N.A.	Investigative	[109]
4-Benzyl-1-chroman-3-ylmethyl-piperidine	DMAZMPF	Discovery agent	N.A.	Investigative	[109]
5,6-dichloro-3,4-dihydroquinazolin-2-amine	DMN1S35	Discovery agent	N.A.	Investigative	[121]
5-chloro-3,4-dihydroquinazolin-2-amine	DMKEFJ0	Discovery agent	N.A.	Investigative	[121]
5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine	DMGDTNI	Discovery agent	N.A.	Investigative	[121]
5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine	DM7FZU2	Discovery agent	N.A.	Investigative	[121]
5-CT	DM260KD	Discovery agent	N.A.	Investigative	[122]
7-methoxy-1-naphthylpiperazine	DM3MXI5	Discovery agent	N.A.	Investigative	[107]
8-Methoxy-1,2,3,4-tetrahydro-naphthalen-2-ylamine	DMFOM10	Discovery agent	N.A.	Investigative	[5]
8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline	DMQIFZC	Discovery agent	N.A.	Investigative	[96]
8-Methoxy-2-piperazin-1-yl-quinoline	DMNWC29	Discovery agent	N.A.	Investigative	[96]
8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine	DMK6U2V	Discovery agent	N.A.	Investigative	[121]
8-Methoxy-quinolin-2-ylamine	DMHZ5SB	Discovery agent	N.A.	Investigative	[96]
9-Methoxy-1,2,3,4-tetrahydro-anthracen-2-ylamine	DM1YK42	Discovery agent	N.A.	Investigative	[5]
9-OH-risperidone	DMGORXQ	Discovery agent	N.A.	Investigative	[123]
A-987306	DMU34BK	Discovery agent	N.A.	Investigative	[124]
AGROCLAVINE	DMT9FJZ	Discovery agent	N.A.	Investigative	[125]
BRL-15572	DMM61Y2	Discovery agent	N.A.	Investigative	[126]
Brolamfetamine	DMC4PF0	Discovery agent	N.A.	Investigative	[99]
CGS-19480A	DMC41UH	Anxiety disorder	6B00-6B0Z	Investigative	[127], [15]
Chlorophenylpiperazine	DMOA8L2	Discovery agent	N.A.	Investigative	[102]
CP 93129	DMSNVKP	Discovery agent	N.A.	Investigative	[122]
Cyamemazine	DMZ6YPV	Discovery agent	N.A.	Investigative	[128]
EDMT	DMS3AXK	Discovery agent	N.A.	Investigative	[129]
EMD 56551	DM4SEMA	Discovery agent	N.A.	Investigative	[130]
ESCHOLTZINE	DMPTDHC	Discovery agent	N.A.	Investigative	[131]
Etisulergine	DMKH8TC	Discovery agent	N.A.	Investigative	[132]
FG-5893	DM1NL3Z	Discovery agent	N.A.	Investigative	[133]
GR 125,743	DMMX7KL	Discovery agent	N.A.	Investigative	[122]
JNJ-10392980	DMZH0K8	Discovery agent	N.A.	Investigative	[134]
L-772,405	DM5O0CM	Discovery agent	N.A.	Investigative	[135]
LP-12	DM8ZR17	Discovery agent	N.A.	Investigative	[136]
LP-211	DMKDGLA	Discovery agent	N.A.	Investigative	[137]
LP-44	DM0C3SF	Discovery agent	N.A.	Investigative	[136]
LY 165,163	DM9IU21	Discovery agent	N.A.	Investigative	[133]
LY433221	DMHQ0T2	Depression	6A70-6A7Z	Investigative	[138]
MCL-516	DMQA7ZI	Discovery agent	N.A.	Investigative	[94]
MPDT	DMYX31S	Discovery agent	N.A.	Investigative	[129]
N-(3-(1H-indol-4-yloxy)propyl)cyclohexanamine	DM0JE7H	Discovery agent	N.A.	Investigative	[119]
N-(3-(1H-indol-4-yloxy)propyl)cyclopentanamine	DM2URTK	Discovery agent	N.A.	Investigative	[119]
N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide	DMCJWQT	Discovery agent	N.A.	Investigative	[137]
N-methyllaurotetanine	DMWPBKU	Discovery agent	N.A.	Investigative	[131]
N-[4-(4-Phenyl-piperazin-1-yl)-butyl]-benzamide	DMA4L5P	Discovery agent	N.A.	Investigative	[139]
nafadotride	DM79KLR	Discovery agent	N.A.	Investigative	[133]
NPT-500	DMMUY73	Major depressive disorder	6A70.3	Investigative	[43]
P-MPPI	DMHSWT6	Discovery agent	N.A.	Investigative	[140], [84]
p-[18F]MPPF	DM9SNFX	Discovery agent	N.A.	Investigative	[141]
PB-28	DMSXZ19	Discovery agent	N.A.	Investigative	[142]
PG-01037	DM2TP4Q	Discovery agent	N.A.	Investigative	[143]
PHENYLPIPERAZINE	DMWAK1R	Discovery agent	N.A.	Investigative	[96]
piribedil	DMNP6QD	Discovery agent	N.A.	Investigative	[144]
Quipazine	DMPY6IG	Discovery agent	N.A.	Investigative	[145]
Repinotan	DM47TSV	Discovery agent	N.A.	Investigative	[146]
RS-30199	DMDC1B4	Discovery agent	N.A.	Investigative	[147]
S-14671	DMHVEJF	Discovery agent	N.A.	Investigative	[28]
SB 216641	DMB3R4Z	Discovery agent	N.A.	Investigative	[126]
SB 272183	DMOLNQX	Discovery agent	N.A.	Investigative	[148]
SB 649915	DM21Z6H	Discovery agent	N.A.	Investigative	[149]
SB 714786	DMGHRY0	Discovery agent	N.A.	Investigative	[149]
SB-271046	DM5VJAF	Discovery agent	N.A.	Investigative	[150]
SB-656104	DMVOIL5	Discovery agent	N.A.	Investigative	[151]
SEL-73	DMFKE6C	Psychiatric disorder	6E8Z	Investigative	[43]
Serotonin	DMOFCRY	Discovery agent	N.A.	Investigative	[145]
SNAP-8719	DMCHPMA	Discovery agent	N.A.	Investigative	[152]
spiroxatrine	DMPHRXQ	Discovery agent	N.A.	Investigative	[133]
SR-59026	DMCRVM2	Discovery agent	N.A.	Investigative	[153]
TFMPP	DMAC8TP	Discovery agent	N.A.	Investigative	[92]
U92016A	DM7CJNE	Discovery agent	N.A.	Investigative	[154]
UH-232	DM5K6ZE	Discovery agent	N.A.	Investigative	[155]
UH-301	DM5NYWV	N. A.	N. A.	Investigative	[156]
WAY 100135	DMC6KYF	Discovery agent	N.A.	Investigative	[84]
WAY-466	DMMOH51	Discovery agent	N.A.	Investigative	[157]
[11C]WAY100635	DMXIEA1	Discovery agent	N.A.	Investigative	[158]
[3H]8-OH-DPAT	DM4KCYU	Discovery agent	N.A.	Investigative	[159]
[3H]NLX-112	DMG1TIV	Discovery agent	N.A.	Investigative	[160]
[3H]p-MPPF	DM2LA9X	Discovery agent	N.A.	Investigative	[161]
[3H]robalzotan	DMK1TRG	Discovery agent	N.A.	Investigative	[162]
[3H]spiperone	DMWHEV8	Discovery agent	N.A.	Investigative	[91]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Major depressive disorder	6A20	Pre-frontal cortex	7.48E-01	-1.45E-04	-5.19E-04
Lateral sclerosis	8A00.0	Cervical spinal cord	2.18E-01	-0.11	-0.51
Alzheimer's disease	8A00.0	Entorhinal cortex	1.49E-05	-0.22	-0.58
Schizophrenia	6A20	Pre-frontal cortex	7.49E-01	-0.02	-0.06
Schizophrenia	6A20	Superior temporal cortex	3.45E-01	-0.02	-0.14
Coronary artery disease	BA80-BA8Z	Peripheral blood	4.62E-01	-0.14	-0.76
Parkinson's disease	8A00.0	Substantia nigra tissue	5.70E-01	-0.13	-0.53

References

• [1] Interactions between corticotropin-releasing hormone and serotonin: implications for the aetiology and treatment of anxiety disorders. Handb Exp Pharmacol. 2005;(169):181-204.
• [2] Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651.
• [3] Effects of brexpiprazole, a novel serotonin-dopamine activity modulator, on phencyclidine-induced cognitive deficits in mice: a role for serotonin 5-HT1A receptors.Pharmacol Biochem Behav.2014 Sep;124:245-9.
• [4] Brexpiprazole: First Global Approval.Drugs.2015 Sep;75(14):1687-97.
• [5] Synthesis of new derivatives of 8-OH-DPAT: Influence of substitution on the aromatic ring on the pharmacological profile, Bioorg. Med. Chem. Lett. 3(10):2035-2038 (1993).
• [6] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [7] Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
• [8] Urapidil. A reappraisal of its use in the management of hypertension. Drugs. 1998 Nov;56(5):929-55.
• [9] 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
• [10] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127)
• [11] Clinical pipeline report, company report or official report of Jazz Pharmaceuticals.
• [12] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [13] Pharma & Vaccines. Product Development Pipeline. April 29 2009.
• [14] A positron emission tomography study to assess binding of lecozotan, a novel 5-hydroxytryptamine-1A silent antagonist, to brain 5-HT1A receptors in... Clin Pharmacol Ther. 2008 Jan;83(1):86-96.
• [15] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [16] Dual ligands targeting dopamine D2 and serotonin 5-HT1A receptors as new antipsychotical or anti-Parkinsonian agents.Curr Med Chem.2014;21(4):437-57.
• [17] Ensaculin (KA-672 HCl): a multitransmitter approach to dementia treatment. CNS Drug Rev. 2002 Summer;8(2):143-58.
• [18] The discriminative stimulus effects of KA 672, a putative cognitive enhancer: evidence for a 5-HT1A component. Pharmacol Biochem Behav. 1998 Jul;60(3):703-7.
• [19] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [20] Company report (Minerva Neurosciences),MIN-101,Schizophrenia, 6 trials completed; Once a day formulation completed , Phase IIa completed; Phase IIb enrollment ongoing and expected to continue over the last 3 quarters of 2015.
• [21] Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
• [22] Clinical pipeline report, company report or official report of Neurim Pharmaceuticals.
• [23] Antidepressant-like responses to the combined sigma and 5-HT1A receptor agonist OPC-14523. Neuropharmacology. 2001 Dec;41(8):976-88.
• [24] Antagonism of the 5-HT1A receptor stimulus in a conditioned taste aversion procedure. Eur Neuropsychopharmacol. 1999 Jun;9(4):345-9.
• [25] Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271
• [26] EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22.
• [27] S 15535, a benzodioxopiperazine acting as presynaptic agonist and postsynaptic 5-HT1A receptor antagonist, prevents the impairment of spatial learning caused by intrahippocampal scopolamine. Br J Pharmacol. 1999 Nov;128(6):1207-14.
• [28] Labelling of recombinant human and native rat serotonin 5-HT1A receptors by a novel, selective radioligand, [3H]-S 15535: definition of its binding profile using agonists, antagonists and inverse agonists. Naunyn Schmiedebergs Arch Pharmacol. 1998 Mar;357(3):205-17.
• [29] S 16924 ((R)-2-[1-[2-(2,3-dihydro-benzo[1,4] dioxin-5-Yloxy)-ethyl]-pyrrolidin-3yl]-1-(4-fluoro-phenyl)-ethanone), a novel, potential antipsychotic with marked serotonin (5-HT)1A agonist properties: I. Receptorial and neurochemical profile in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1998 Sep;286(3):1341-55.
• [30] S-16924 [(R)-2-[1-[2-(2,3-dihydro-benzo[1,4]dioxin-5-yloxy)-ethyl]- pyrrolidin-3yl]-1-(4-fluorophenyl)-ethanone], a novel, potential antipsychotic with marked serotonin1A agonist properties: III. Anxiolytic actions in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1999 Mar;288(3):1002-14.
• [31] DOI: 10.1038/sj.mp.4002062
• [32] Experimental study of pharmacological hypothermia: enhanced neuroprotective effect of a novel 5-HT 1 A agonist SUN N4057 by the pharmacological hypothermia. No To Shinkei. 2001 Sep;53(9):853-8.
• [33] Company report (Fabrekramer)
• [34] 50 years of hurdles and hope in anxiolytic drug discovery. Nat Rev Drug Discov. 2013 Sep;12(9):667-87.
• [35] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032503)
• [36] Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals.
• [37] The serotonin 5-HT receptor agonist tandospirone improves executive function in common marmosets. Behav Brain Res. 2015 Jul 1;287:120-6.
• [38] The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
• [39] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412)
• [40] DSP-1053, a novel serotonin reuptake inhibitor with 5-HT1A partial agonistic activity, displays fast antidepressant effect with minimal undesirable effects in juvenile rats. Pharmacol Res Perspect. 2015 Jun;3(3):e00142.
• [41] Clinical pipeline report, company report or official report of GlaxoSmithKline.
• [42] In vivo electrophysiological and neurochemical effects of the selective 5-HT1A receptor agonist, F13640, at pre- and postsynaptic 5-HT1A receptors in the rat.Psychopharmacology (Berl).2012 May;221(2):261-72.
• [43] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1).
• [44] SSR181507, a dopamine D receptor and 5-HT() receptor ligand: evidence for mixed anxiolytic- and antidepressant-like activities.Pharmacol Biochem Behav.2011 Jan;97(3):428-35.
• [45] The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96.
• [46] 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689.
• [47] Stereoselective LSD-like activity in a series of d-lysergic acid amides of (R)- and (S)-2-aminoalkanes. J Med Chem. 1995 Mar 17;38(6):958-66.
• [48] Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86.
• [49] BMY 14802, a sigma receptor ligand for the treatment of schizophrenia. Neuropsychopharmacology. 1994 Feb;10(1):37-40.
• [50] The effects of BMY-14802 against L-DOPA- and dopamine agonist-induced dyskinesia in the hemiparkinsonian rat
• [51] Effect of sustained administration of the 5-HT1A receptor agonist flesinoxan on rat 5-HT neurotransmission. Eur Neuropsychopharmacol. 1999 Sep;9(5):427-40.
• [52] An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment o... J Med Chem. 2006 Jun 1;49(11):3116-35.
• [53] Synthesis and biological activity of the putative metabolites of the atypical antipsychotic agent tiospirone. J Med Chem. 1991 Nov;34(11):3316-28.
• [54] Synthesis and SAR of adatanserin: novel adamantyl aryl- and heteroarylpiperazines with dual serotonin 5-HT(1A) and 5-HT(2) activity as potential anxiolytic and antidepressant agents. J Med Chem. 1999Dec 16;42(25):5077-94.
• [55] Chronic alnespirone-induced desensitization of somatodendritic 5-HT1A autoreceptors in the rat dorsal raphe nucleus. Eur J Pharmacol. 1999 Jan 22;365(2-3):165-73.
• [56] The effects of AP521, a novel anxiolytic drug, in three anxiety models and on serotonergic neural transmission in rats. J Pharmacol Sci. 2015 Jan;127(1):109-16.
• [57] 5-Hydroxytryptamine1A receptor occupancy by novel full antagonist 2-[4-[4-(7-chloro-2,3-dihydro-1,4-benzdioxyn-5-yl)-1-piperazinyl]butyl]-1,2-benzisothiazol-3-(2H)-one-1,1-dioxide: a[11C][O-methyl-3H]-N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide trihydrochloride (WAY-100635) positron emission tomography study in humans. J Pharmacol Exp Ther. 2002 Jun;301(3):1144-50.
• [58] Effect of acute administration of the 5-HT1A receptor ligand, lesopitron, on rat cortical 5-HT and dopamine turnover. Br J Pharmacol. 1994 Oct;113(2):425-30.
• [59] A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2.
• [60] PRX-00023, a selective serotonin 1A receptor agonist, reduces ultrasonic vocalizations in infant rats bred for high infantile anxiety.Pharmacol Biochem Behav.2009 Nov;94(1):8-15.
• [61] N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-nitrophenyl) cyclohexanecarboxamide: a novel pre- and postsynaptic 5-hydroxytryptamine(1A) receptor antagonist active on the lower urinary tract. JPharmacol Exp Ther. 2001 Dec;299(3):1027-37.
• [62] Use of PET and the radioligand [carbonyl-(11)C]WAY-100635 in psychotropic drug development. Nucl Med Biol. 2000 Jul;27(5):515-21.
• [63] Quantifying the 5-HT1A agonist action of buspirone in man. Psychopharmacology (Berl). 2001 Nov;158(3):224-9.
• [64] A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14.
• [65] In vitro interactions between a potential muscle relaxant E2101 and human cytochromes P450. Drug Metab Dispos. 2002 Jul;30(7):805-13.
• [66] The pharmacological profile of (R)-3,4-dihydro-N-isopropyl-3-(N-isopropyl-N-propylamino)-2H-1-benzopyran-5-carboxamide, a selective 5-hydroxytryptamine(1A) receptor agonist. J Pharmacol Exp Ther. 2001 Dec;299(3):883-93.
• [67] The use of sleep measures to compare a new 5HT1A agonist with buspirone in humans. J Psychopharmacol. 2005 Nov;19(6):609-13.
• [68] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531)
• [69] Simultaneous determination of nerisopam, a novel anxiolytic agent showing polymorphic metabolism, and its N-acetyl metabolite from human plasma by a validated high performance liquid chromatographic method. J Chromatogr B Biomed Appl. 1996 Mar 29;678(1):63-72.
• [70] Synthesis and dual D2 and 5-HT1A receptor binding affinities of 7-piperazinyl and 7-piperidinyl-3,4-dihydroquinazolin-2(1H)-ones. Med Chem. 2014;10(5):484-96.
• [71] Effects of SUN 8399, a potent and selective 5-HT1A agonist, on conflict behavior and ambulatory activity in mice: comparison with those of buspirone, tandospirone and diazepam. Jpn J Pharmacol. 1994 Apr;64(4):273-80.
• [72] Tolerance development to the vagal-mediated bradycardia produced by 5-HT1A receptor agonists. J Pharmacol Exp Ther. 1994 Nov;271(2):776-81.
• [73] CN patent application no. 104151292, Indole derivative or a pharmaceutically acceptable salt thereof.
• [74] Cardiovascular activity of A-74283, a 5-hydroxytryptamine 1A agent, in the spontaneously hypertensive rat. Pharmacology. 1998 Jan;56(1):17-29.
• [75] Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43.
• [76] Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32.
• [77] 8-[4-[2-(1,2,3,4-Tetrahydroisoquinolinyl]butyl-8-azaspiro[4.5]decane-7,9-dione: a new 5-HT1A receptor ligand with the same activity profile as busp... J Med Chem. 1996 Mar 1;39(5):1125-9.
• [78] Quantitative determination of CGS 18102A, a new anxiolytic, in human plasma using capillary gas chromatography/mass spectrometry. Biomed Chromatogr. 1992 Sep-Oct;6(5):244-7.
• [79] Synthesis, SAR and pharmacology of CP-293,019: a potent, selective dopamine D4 receptor antagonist. Bioorg Med Chem Lett. 1998 Apr 7;8(7):725-30.
• [80] Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82.
• [81] Pharmacological profile of (-)HT-90B, a novel 5-HT1A receptor agonist/5-HT2 receptor antagonist. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1201-16.
• [82] Chronic voluntary ethanol intake hypersensitizes 5-HT(1A) autoreceptors in C57BL/6J mice. J Neurochem. 2008 Dec;107(6):1660-70.
• [83] Pharmacological characterization of LY293284: A 5-HT1A receptor agonist with high potency and selectivity. J Pharmacol Exp Ther. 1994 Sep;270(3):1270-81.
• [84] Influence of 5-HT1A receptor antagonism on plus-maze behaviour in mice. II. WAY 100635, SDZ 216-525 and NAN-190. Pharmacol Biochem Behav. 1997 Oct;58(2):593-603.
• [85] Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem. 1995 Oct 13;38(21):4198-210.
• [86] S 14506: novel receptor coupling at 5-HT(1A) receptors. Neuropharmacology. 2001 Mar;40(3):334-44.
• [87] Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9.
• [88] Pharmacological characterization of recombinant human 5-hydroxytryptamine1A receptors using a novel antagonist radioligand, [3H]WAY-100635. Life Sci. 1997;60(9):653-65.
• [89] Cocaine and serotonin: a role for the 5-HT(1A) receptor site in the mediation of cocaine stimulant effects. Behav Brain Res. 2001 Nov 29;126(1-2):127-33.
• [90] Involvement of 5-hydroxytryptamine(1A) receptors in nicotine-induced tail tremor in rats. Eur J Pharmacol. 2000 Nov 10;408(1):19-23.
• [91] Synthesis of (R,S)-trans-8-hydroxy-2-[N-n-propyl-N-(3'-iodo-2'-propenyl)amino]tetral in (trans-8-OH-PIPAT): a new 5-HT1A receptor ligand. J Med Chem. 1993 Oct 15;36(21):3161-5.
• [92] Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. J Med Chem. 1986 May;29(5):630-4.
• [93] R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30.
• [94] Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. Bioorg Med Chem. 2008 Jul 15;16(14):6675-81.
• [95] The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl). 2001 Aug;157(1):111-4.
• [96] 5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. J Med Chem. 1986 Nov;29(11):2375-80.
• [97] Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7.
• [98] 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28.
• [99] 5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. J Med Chem. 1986 Feb;29(2):194-9.
• [100] Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7.
• [101] Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7.
• [102] Activity of aromatic substituted phenylpiperazines lacking affinity for dopamine binding sites in a preclinical test of antipsychotic efficacy. J Med Chem. 1989 May;32(5):1052-6.
• [103] Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. J Med Chem. 1991 Jun;34(6):1850-4.
• [104] Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new ... J Med Chem. 1994 Aug 19;37(17):2754-60.
• [105] Identification of a red-emitting fluorescent ligand for in vitro visualization of human serotonin 5-HT(1A) receptors. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6628-32.
• [106] The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66.
• [107] 5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. J Med Chem. 1997 Nov 21;40(24):3974-8.
• [108] Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. J Med Chem. 2006 Nov 2;49(22):6607-13.
• [109] Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem. 2005 Jan 13;48(1):266-73.
• [110] Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31.
• [111] Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997).
• [112] Novel aminoethylbiphenyls as 5-HT7 receptor ligands. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3018-22.
• [113] SAR studies on new bis-aryls 5-HT7 ligands: Synthesis and molecular modeling. Bioorg Med Chem. 2010 Mar 1;18(5):1958-67.
• [114] 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997).
• [115] A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem. 2003 Sep 11;46(19):4188-95.
• [116] 3-(1,2,5,6-Tetrahydropyrid-4-yl)pyrrolo[3,2-b]pyrid-5-one: a potent and selective serotonin (5-HT1B) agonist and rotationally restricted phenolic a... J Med Chem. 1990 Aug;33(8):2087-93.
• [117] New generation dopaminergic agents. 2. Discovery of 3-OH-phenoxyethylamine and 3-OH-N1-phenylpiperazine dopaminergic templates. Bioorg Med Chem Lett. 1998 Feb 3;8(3):295-300.
• [118] 6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. J Med Chem. 1992 Oct 30;35(22):3984-90.
• [119] Indoloxypropanolamine analogues as 5-HT(1A) receptor antagonists. Bioorg Med Chem Lett. 2007 Oct 15;17(20):5600-4.
• [120] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [121] Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61.
• [122] Agonist activity of antimigraine drugs at recombinant human 5-HT1A receptors: potential implications for prophylactic and acute therapy. Naunyn Schmiedebergs Arch Pharmacol. 1997 Jun;355(6):682-8.
• [123] Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73.
• [124] cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8.
• [125] Ergolines as selective 5-HT1 agonists. J Med Chem. 1988 Aug;31(8):1512-9.
• [126] SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20.
• [127] WO patent application no. 2012,0025,83, Method for treating schizophrenia and related diseases with a combination therapy.
• [128] Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40.
• [129] 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8.
• [130] Diagnosis of migraine with aura, depression and anxiety from allelic variations in dopaminergic genes
• [131] Alkaloids from Eschscholzia californica and their capacity to inhibit binding of [3H]8-Hydroxy-2-(di-N-propylamino)tetralin to 5-HT1A receptors in ... J Nat Prod. 2006 Mar;69(3):432-5.
• [132] Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-... J Med Chem. 1985 Oct;28(10):1540-2.
• [133] Agonist and antagonist actions of antipsychotic agents at 5-HT1A receptors: a [35S]GTPgammaS binding study. Eur J Pharmacol. 1998 Aug 21;355(2-3):245-56.
• [134] Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69.
• [135] 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001.
• [136] Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21.
• [137] Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22.
• [138] Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23.
• [139] Arylpiperazine derivatives as high-affinity 5-HT1A serotonin ligands. J Med Chem. 1988 Oct;31(10):1968-71.
• [140] p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90.
• [141] A 18F-MPPF PET normative database of 5-HT1A receptor binding in men and women over aging. J Nucl Med. 2005 Dec;46(12):1980-9.
• [142] New sigma and 5-HT1A receptor ligands: omega-(tetralin-1-yl)-n-alkylamine derivatives. J Med Chem. 1996 Jan 5;39(1):176-82.
• [143] Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46.
• [144] Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804.
• [145] Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characteri... J Med Chem. 2009 Nov 12;52(21):6946-50.
• [146] Characterization of the aminomethylchroman derivative BAY x 3702 as a highly potent 5-hydroxytryptamine1A receptor agonist. J Pharmacol Exp Ther. 1998 Mar;284(3):1082-94.
• [147] Interaction of the anxiogenic agent, RS-30199, with 5-HT1A receptors: modulation of sexual activity in the male rat. Neuropharmacology. 1998 Jun;37(6):769-80.
• [148] SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806.
• [149] Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80.
• [150] Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43.
• [151] Novel 3-aminochromans as potential pharmacological tools for the serotonin 5-HT(7) receptor. Bioorg Med Chem Lett. 2005 Feb 1;15(3):747-50.
• [152] Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione ... J Med Chem. 2005 Apr 21;48(8):3076-9.
• [153] Effect of SR 59026A, a new 5-HT(1A) receptor agonist, on sexual activity in male rats. Behav Pharmacol. 1995 Apr;6(3):276-282.
• [154] Characterization of U-92016A as a selective, orally active, high intrinsic activity 5-hydroxytryptamine1A agonist. J Pharmacol Exp Ther. 1994 Nov;271(2):875-83.
• [155] (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997).
• [156] N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7.
• [157] Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6.
• [158] [11C]-WAY100635 PET demonstrates marked 5-HT1A receptor changes in sporadic ALS. Brain. 2005 Apr;128(Pt 4):896-905.
• [159] Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10.
• [160] [(3)H]-F13640, a novel, selective and high-efficacy serotonin 5-HT(1A) receptor agonist radioligand. Naunyn Schmiedebergs Arch Pharmacol. 2010 Oct;382(4):321-30.
• [161] Ligand binding characteristics of the human serotonin1A receptor heterologously expressed in CHO cells. Biosci Rep. 2004 Apr;24(2):101-15.
• [162] Receptor binding characteristics of [3H]NAD-299, a new selective 5-HT1A receptor antagonist. Eur J Pharmacol. 1998 Nov 6;360(2-3):219-25.