Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT562DA1)

• DOT Name: Fatty acid-binding protein, heart (FABP3)
• Synonyms: Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP
• Gene Name: FABP3
• UniProt ID: FABPH_HUMAN
• PDB ID: 1G5W ; 1HMR ; 1HMS ; 1HMT ; 2HMB ; 3RSW ; 3WBG ; 3WVM ; 3WXQ ; 4TJZ ; 4TKB ; 4TKH ; 4TKJ ; 4WBK ; 5B27 ; 5B28 ; 5B29 ; 5CE4 ; 5HZ9 ; 6AQ1 ; 7EGO ; 7EUV ; 7EUW ; 7FBF ; 7FBM ; 7FBN ; 7FC4 ; 7FCG ; 7FCX ; 7FD7 ; 7FDT ; 7FDU ; 7FDX ; 7FEK ; 7FEU ; 7FEZ ; 7FF6 ; 7FFK ; 7FFX ; 7FG1 ; 7FG5 ; 7FZQ ; 7V2G ; 7V5U ; 7VB1 ; 7WCI ; 7WD6 ; 7WDJ ; 7WE5 ; 7WF0 ; 7WJ1 ; 7WKB ; 7WKG ; 7WOM ; 7WPG ; 7WPU ; 7WPW ; 7WQ7 ; 7X48 ; 7X4J ; 7X50 ; 7XBC ; 7XHM ; 7XHU ; 8GEW
• Pfam ID: PF00061
• Sequence:
  MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
  TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
  GTAVCTRTYEKEA
• Function: FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
• KEGG Pathway: PPAR sig.ling pathway (hsa03320)
• Reactome Pathway: Triglyceride catabolism (R-HSA-163560)

Molecular Interaction Atlas (MIA) of This DOT

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Fatty acid-binding protein, heart (FABP3).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Fatty acid-binding protein, heart (FABP3).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Fatty acid-binding protein, heart (FABP3).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Fatty acid-binding protein, heart (FABP3).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Fatty acid-binding protein, heart (FABP3).	[5]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Fatty acid-binding protein, heart (FABP3).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Fatty acid-binding protein, heart (FABP3).	[4]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Fatty acid-binding protein, heart (FABP3).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Fatty acid-binding protein, heart (FABP3).	[8]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Fatty acid-binding protein, heart (FABP3).	[9]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Fatty acid-binding protein, heart (FABP3).	[10]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Fatty acid-binding protein, heart (FABP3).	[11]
Benzatropine	DMF7EXL	Approved	Benzatropine increases the expression of Fatty acid-binding protein, heart (FABP3).	[12]
Methamphetamine	DMPM4SK	Approved	Methamphetamine increases the expression of Fatty acid-binding protein, heart (FABP3).	[13]
Haloperidol	DM96SE0	Approved	Haloperidol increases the expression of Fatty acid-binding protein, heart (FABP3).	[12]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of Fatty acid-binding protein, heart (FABP3).	[14]
Bezafibrate	DMZDCS0	Approved	Bezafibrate decreases the expression of Fatty acid-binding protein, heart (FABP3).	[15]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Fatty acid-binding protein, heart (FABP3).	[7]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Fatty acid-binding protein, heart (FABP3).	[16]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Fatty acid-binding protein, heart (FABP3).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Fatty acid-binding protein, heart (FABP3).	[19]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Fatty acid-binding protein, heart (FABP3).	[20]
Linoleic acid	DMDGPY9	Investigative	Linoleic acid decreases the expression of Fatty acid-binding protein, heart (FABP3).	[15]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Fatty acid-binding protein, heart (FABP3).	[17]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [7] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [8] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [9] Effects of troglitazone on cellular differentiation, insulin signaling, and glucose metabolism in cultured human skeletal muscle cells. Biochem Biophys Res Commun. 2001 Jan 26;280(3):664-74. doi: 10.1006/bbrc.2000.4216.
• [10] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [11] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [12] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [13] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [14] Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
• [15] Expression of cFABP and PPAR in trophoblast cells: effect of PPAR ligands on linoleic acid uptake and differentiation. Biochim Biophys Acta. 2005 Feb 21;1687(1-3):181-94. doi: 10.1016/j.bbalip.2004.11.017.
• [16] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [17] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [18] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [19] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
• [20] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.