Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAT6TI6)

• DOT Name: Interferon-induced transmembrane protein 2 (IFITM2)
• Synonyms: Dispanin subfamily A member 2c; DSPA2c; Interferon-inducible protein 1-8D
• Gene Name: IFITM2
• Related Disease:
  Neoplasm
  Adenocarcinoma
  Atopic dermatitis
  Colon carcinoma
  Squamous cell carcinoma
  Gastric cancer
  Stomach cancer
• UniProt ID: IFM2_HUMAN
• Pfam ID: PF04505
• Sequence:
  MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWS
  LFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILL
  IIIPVLVVQAQR
• Function: IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), hepatitis C virus (HCV) and vesicular stomatitis virus (VSV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV and SARS-CoV-2 S protein-mediated viral entry and VSV G protein-mediated viral entry. Induces cell cycle arrest and mediates apoptosis by caspase activation and in p53-independent manner. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation. IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome.
• Reactome Pathway: Interferon alpha/beta signaling (R-HSA-909733)

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[3]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[4]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[2]
Gastric cancer	DISXGOUK	moderate	Biomarker	[5]
Stomach cancer	DISKIJSX	moderate	Biomarker	[5]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Interferon-induced transmembrane protein 2 (IFITM2) decreases the response to substance of Arsenic.	[27]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[6]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[7]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[8]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[9]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[10]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[11]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[12]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[11]
Selenium	DM25CGV	Approved	Selenium increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[15]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[16]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[17]
Coprexa	DMA0WEK	Phase 3	Coprexa increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[18]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[15]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[19]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[20]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[21]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[23]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[24]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[25]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Interferon-induced transmembrane protein 2 (IFITM2).	[26]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Interferon-induced transmembrane protein 2 (IFITM2).	[22]

References

• [1] Role of BAG3 in cancer progression: A therapeutic opportunity.Semin Cell Dev Biol. 2018 Jun;78:85-92. doi: 10.1016/j.semcdb.2017.08.049. Epub 2017 Aug 31.
• [2] Gene expression profiling in two morphologically different uterine cervical carcinoma cell lines derived from a single donor using a human cancer cDNA array.Gynecol Oncol. 2004 May;93(2):446-53. doi: 10.1016/j.ygyno.2004.02.012.
• [3] Mechanisms of IFN--induced apoptosis of human skin keratinocytes in patients with atopic dermatitis.J Allergy Clin Immunol. 2012 May;129(5):1297-306. doi: 10.1016/j.jaci.2012.02.020. Epub 2012 Mar 24.
• [4] The human 1-8D gene (IFITM2) is a novel p53 independent pro-apoptotic gene.Int J Cancer. 2009 Dec 15;125(12):2810-9. doi: 10.1002/ijc.24669.
• [5] IGF1/IGF1R/STAT3 signaling-inducible IFITM2 promotes gastric cancer growth and metastasis.Cancer Lett. 2017 May 1;393:76-85. doi: 10.1016/j.canlet.2017.02.014. Epub 2017 Feb 20.
• [6] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [7] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [8] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [9] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [10] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [11] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [12] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [13] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [14] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [15] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [16] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [17] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [18] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [19] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [20] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [21] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [22] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [23] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [24] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [25] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [26] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [27] Gene expression levels in normal human lymphoblasts with variable sensitivities to arsenite: identification of GGT1 and NFKBIE expression levels as possible biomarkers of susceptibility. Toxicol Appl Pharmacol. 2008 Jan 15;226(2):199-205. doi: 10.1016/j.taap.2007.09.004. Epub 2007 Sep 15.