Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG1P60E)

• DOT Name: Insulin-like growth factor-binding protein 2 (IGFBP2)
• Synonyms: IBP-2; IGF-binding protein 2; IGFBP-2
• Gene Name: IGFBP2
• UniProt ID: IBP2_HUMAN
• PDB ID: 2H7T
• Pfam ID: PF00219 ; PF00086
• Sequence:
  MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAP
  PAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELP
  LQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKP
  LKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIST
  MRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
  RGDPECHLFYNEQQEARGVHTQRMQ
• Function: Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
• Reactome Pathway: Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DOT

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[10]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[11]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[12]
Selenium	DM25CGV	Approved	Selenium increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[13]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[14]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[15]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[16]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[17]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[16]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[18]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[19]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[20]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[11]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[11]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[21]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[3]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[13]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[23]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[24]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[26]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[27]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[28]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[29]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID increases the expression of Insulin-like growth factor-binding protein 2 (IGFBP2).	[21]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Insulin-like growth factor-binding protein 2 (IGFBP2).	[22]

References

• [1] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Role of NADPH oxidase in arsenic-induced reactive oxygen species formation and cytotoxicity in myeloid leukemia cells. Proc Natl Acad Sci U S A. 2004 Mar 30;101(13):4578-83.
• [10] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [11] DHT and testosterone, but not DHEA or E2, differentially modulate IGF-I, IGFBP-2, and IGFBP-3 in human prostatic stromal cells. Am J Physiol Endocrinol Metab. 2006 May;290(5):E952-60. doi: 10.1152/ajpendo.00451.2005. Epub 2005 Dec 20.
• [12] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [13] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [14] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [15] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [16] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [17] Analysis of gene expression induced by diethylstilbestrol (DES) in human primitive Mullerian duct cells using microarray. Cancer Lett. 2005 Apr 8;220(2):197-210.
• [18] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [19] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [20] Ethinylestradiol and testosterone have divergent effects on circulating IGF system components in adolescents with constitutional tall stature. Eur J Endocrinol. 2005 Apr;152(4):597-604. doi: 10.1530/eje.1.01880.
• [21] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [22] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [23] The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
• [24] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [25] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [26] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [27] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [28] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [29] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.