Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIPDI15)

DOT Name Beta/gamma crystallin domain-containing protein 1 (CRYBG1)
Synonyms Absent in melanoma 1 protein
Gene Name CRYBG1
Related Disease
Melanoma ( )
Metastatic prostate carcinoma ( )
Mixed anxiety and depressive disorder ( )
Obesity ( )
Oculocutaneous albinism ( )
Plasma cell myeloma ( )
Prostate cancer ( )
Metastatic melanoma ( )
Prostate carcinoma ( )
Asthma ( )
Neoplasm ( )
Patent ductus arteriosus ( )
UniProt ID
CRBG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2DAD; 3CW3; 6VRO
Pfam ID
PF00030 ; PF00652
Sequence
MEKRSSGRRSGRRRGSQKSTDSPGADAELPESAARDDAVFDDEVAPNAASDNASAEKKVK
SPRAALDGGVASAASPESKPSPGTKGQLRGESDRSKQPPPASSPTKRKGRSRALEAVPAP
PASGPRAPAKESPPKRVPDPSPVTKGTAAESGEEAARAIPRELPVKSSSLLPEIKPEHKR
GPLPNHFNGRAEGGRSRELGRAAGAPGASDADGLKPRNHFGVGRSTVTTKVTLPAKPKHV
ELNLKTPKNLDSLGNEHNPFSQPVHKGNTATKISLFENKRTNSSPRHTDIRGQRNTPASS
KTFVGRAKLNLAKKAKEMEQPEKKVMPNSPQNGVLVKETAIETKVTVSEEEILPATRGMN
GDSSENQALGPQPNQDDKADVQTDAGCLSEPVASALIPVKDHKLLEKEDSEAADSKSLVL
ENVTDTAQDIPTTVDTKDLPPTAMPKPQHTFSDSQSPAESSPGPSLSLSAPAPGDVPKDT
CVQSPISSFPCTDLKVSENHKGCVLPVSRQNNEKMPLLELGGETTPPLSTERSPEAVGSE
CPSRVLVQVRSFVLPVESTQDVSSQVIPESSEVREVQLPTCHSNEPEVVSVASCAPPQEE
VLGNEHSHCTAELAAKSGPQVIPPASEKTLPIQAQSQGSRTPLMAESSPTNSPSSGNHLA
TPQRPDQTVTNGQDSPASLLNISAGSDDSVFDSSSDMEKFTEIIKQMDSAVCMPMKRKKA
RMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLR
PKRASAEQSVLFKSLHTNTNGNSEPLVMPEINDKENRDVTNGGIKRSRLEKSALFSSLLS
SLPQDKIFSPSVTSVNTMTTAFSTSQNGSLSQSSVSQPTTEGAPPCGLNKEQSNLLPDNS
LKVFNFNSSSTSHSSLKSPSHMEKYPQKEKTKEDLDSRSNLHLPETKFSELSKLKNDDME
KANHIESVIKSNLPNCANSDTDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPR
PGKVVIYSEPDVSEKCIEVFSDIQDCSSWSLSPVILIKVVRGCWILYEQPNFEGHSIPLE
EGELELSGLWGIEDILERHEEAESDKPVVIGSIRHVVQDYRVSHIDLFTEPEGLGILSSY
FDDTEEMQGFGVMQKTCSMKVHWGTWLIYEEPGFQGVPFILEPGEYPDLSFWDTEEAYIG
SMRPLKMGGRKVEFPTDPKVVVYEKPFFEGKCVELETGMCSFVMEGGETEEATGDDHLPF
TSVGSMKVLRGIWVAYEKPGFTGHQYLLEEGEYRDWKAWGGYNGELQSLRPILGDFSNAH
MIMYSEKNFGSKGSSIDVLGIVANLKETGYGVKTQSINVLSGVWVAYENPDFTGEQYILD
KGFYTSFEDWGGKNCKISSVQPICLDSFTGPRRRNQIHLFSEPQFQGHSQSFEETTSQID
DSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFKSLRFIDVEFS
EPTIILFEREDFKGKKIELNAETVNLRSLGFNTQIRSVQVIGGIWVTYEYGSYRGRQFLL
SPAEVPNWYEFSGCRQIGSLRPFVQKRIYFRLRNKATGLFMSTNGNLEDLKLLRIQVMED
VGADDQIWIYQEGCIKCRIAEDCCLTIVGSLVTSGSKLGLALDQNADSQFWSLKSDGRIY
SKLKPNLVLDIKGGTQYDQNHIILNTVSKEKFTQVWEAMVLYT
Function May function as suppressor of malignant melanoma. It may exert its effects through interactions with the cytoskeleton.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Strong Biomarker [1]
Metastatic prostate carcinoma DISVBEZ9 Strong Biomarker [2]
Mixed anxiety and depressive disorder DISV809X Strong Biomarker [3]
Obesity DIS47Y1K Strong Genetic Variation [3]
Oculocutaneous albinism DISJS7CU Strong Genetic Variation [4]
Plasma cell myeloma DIS0DFZ0 Strong Posttranslational Modification [5]
Prostate cancer DISF190Y Strong Genetic Variation [6]
Metastatic melanoma DISSL43L moderate Posttranslational Modification [1]
Prostate carcinoma DISMJPLE moderate Genetic Variation [6]
Asthma DISW9QNS Limited Biomarker [7]
Neoplasm DISZKGEW Limited Biomarker [8]
Patent ductus arteriosus DIS9P8YS Limited Biomarker [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Topotecan DMP6G8T Approved Beta/gamma crystallin domain-containing protein 1 (CRYBG1) affects the response to substance of Topotecan. [29]
------------------------------------------------------------------------------------
19 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [10]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [11]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [12]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [13]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [14]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [15]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [16]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [17]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [18]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [19]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [20]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [21]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [22]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [19]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [19]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [23]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [25]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [26]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [24]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the phosphorylation of Beta/gamma crystallin domain-containing protein 1 (CRYBG1). [28]
------------------------------------------------------------------------------------

References

1 AIM1 and LINE-1 epigenetic aberrations in tumor and serum relate to melanoma progression and disease outcome.J Invest Dermatol. 2012 Jun;132(6):1689-97. doi: 10.1038/jid.2012.36. Epub 2012 Mar 8.
2 AIM1 is an actin-binding protein that suppresses cell migration and micrometastatic dissemination.Nat Commun. 2017 Jul 26;8(1):142. doi: 10.1038/s41467-017-00084-8.
3 Multimorbidity of overweight and obesity alongside anxiety and depressive disorders in individuals with spinal cord injury.J Spinal Cord Med. 2021 Nov;44(6):992-1000. doi: 10.1080/10790268.2018.1507801. Epub 2018 Sep 5.
4 Mutations in the MATP gene in five German patients affected by oculocutaneous albinism type 4. Hum Mutat. 2004 Feb;23(2):106-110. doi: 10.1002/humu.10311.
5 TGFbetaR2 aberrant methylation is a potential prognostic marker and therapeutic target in multiple myeloma.Int J Cancer. 2009 Oct 15;125(8):1985-91. doi: 10.1002/ijc.24431.
6 Purification and Functional Characterization of the C-Terminal Domain of the -Actin-Binding Protein AIM1 In Vitro.Molecules. 2018 Dec 11;23(12):3281. doi: 10.3390/molecules23123281.
7 Epidermal Growth Factor Removal or Tyrphostin AG1478 Treatment Reduces Goblet Cells & Mucus Secretion of Epithelial Cells from Asthmatic Children Using the Air-Liquid Interface Model.PLoS One. 2015 Jun 9;10(6):e0129546. doi: 10.1371/journal.pone.0129546. eCollection 2015.
8 Molecular features of hepatosplenic T-cell lymphoma unravels potential novel therapeutic targets.Blood. 2012 Jun 14;119(24):5795-806. doi: 10.1182/blood-2011-12-396150. Epub 2012 Apr 17.
9 Early prediction of spontaneous Patent Ductus Arteriosus (PDA) closure and PDA-associated outcomes: a prospective cohort investigation.BMC Pediatr. 2019 Sep 13;19(1):333. doi: 10.1186/s12887-019-1708-z.
10 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
11 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
12 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
13 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
14 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
15 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
16 Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
17 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
18 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
19 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
20 Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
21 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
22 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
23 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
24 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
25 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
26 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
27 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
28 Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
29 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.