General Information of Drug Off-Target (DOT) (ID: OTNUVSDT)

DOT Name Microsomal triglyceride transfer protein large subunit (MTTP)
Gene Name MTTP
Related Disease
Abetalipoproteinemia ( )
UniProt ID
MTP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8EOJ
Pfam ID
PF19444 ; PF01347
Sequence
MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRIS
SNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQ
RPTLLHLIHGKVKEFYSYQNEAVAIENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQA
HQDKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIEDSFVIAVLAEETHNFGL
NFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQAAAIIKAVDSKYTAIPIVGQVFQSHCKG
CPSLSELWRSTRKYLQPDNLSKAEAVRNFLAFIQHLRTAKKEEILQILKMENKEVLPQLV
DAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFASHPNEELLRALISKFKGSIG
SSDIRETVMIITGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKNA
LLPEGIPSLLKYAEAGEGPISHLATTALQRYDLPFITDEVKKTLNRIYHQNRKVHEKTVR
TAAAAIILNNNPSYMDVKNILLSIGELPQEMNKYMLAIVQDILRFEMPASKIVRRVLKEM
VAHNYDRFSRSGSSSAYTGYIERSPRSASTYSLDILYSGSGILRRSNLNIFQYIGKAGLH
GSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSA
SGDPISVVKGLILLIDHSQELQLQSGLKANIEVQGGLAIDISGAMEFSLWYRESKTRVKN
RVTVVITTDITVDSSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQF
EKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF
Function
Catalyzes the transport of triglyceride, cholesteryl ester, and phospholipid between phospholipid surfaces. Required for the assembly and secretion of plasma lipoproteins that contain apolipoprotein B. May be involved in regulating cholesteryl ester biosynthesis in cells that produce lipoproteins.
Tissue Specificity Liver and small intestine. Also found in ovary, testis and kidney.
KEGG Pathway
Fat digestion and absorption (hsa04975 )
Reactome Pathway
Chylomicron assembly (R-HSA-8963888 )
LDL remodeling (R-HSA-8964041 )
VLDL assembly (R-HSA-8866423 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Abetalipoproteinemia DISMSS7T Definitive Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
31 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [3]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [6]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [8]
Aspirin DM672AH Approved Aspirin decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [9]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
Rifampicin DM5DSFZ Approved Rifampicin decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
Sulindac DM2QHZU Approved Sulindac increases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
Bosentan DMIOGBU Approved Bosentan decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [10]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [9]
Tetracycline DMZA017 Approved Tetracycline decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [9]
Clofibrate DMPC1J7 Approved Clofibrate decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [9]
Allopurinol DMLPAOB Approved Allopurinol decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
Tolcapone DM8MNVO Approved Tolcapone increases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [11]
Indinavir DM0T3YH Approved Indinavir decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [12]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [13]
Chloroquine DMSI5CB Phase 3 Trial Chloroquine increases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [14]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [9]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [7]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [14]
Taxifolin DMQJSF9 Preclinical Taxifolin decreases the activity of Microsomal triglyceride transfer protein large subunit (MTTP). [16]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [17]
Oleic acid DM54O1Z Investigative Oleic acid decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [18]
T0901317 DMZQVDI Investigative T0901317 decreases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [19]
Bafilomycin A1 DMUNK59 Investigative Bafilomycin A1 increases the expression of Microsomal triglyceride transfer protein large subunit (MTTP). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 31 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Microsomal triglyceride transfer protein large subunit (MTTP). [15]
------------------------------------------------------------------------------------

References

1 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
7 Drug-induced hepatic steatosis in absence of severe mitochondrial dysfunction in HepaRG cells: proof of multiple mechanism-based toxicity. Cell Biol Toxicol. 2021 Apr;37(2):151-175. doi: 10.1007/s10565-020-09537-1. Epub 2020 Jun 14.
8 Replacement per- and polyfluoroalkyl substances (PFAS) are potent modulators of lipogenic and drug metabolizing gene expression signatures in primary human hepatocytes. Toxicol Appl Pharmacol. 2022 May 1;442:115991. doi: 10.1016/j.taap.2022.115991. Epub 2022 Mar 23.
9 Advantageous use of HepaRG cells for the screening and mechanistic study of drug-induced steatosis. Toxicol Appl Pharmacol. 2016 Jul 1;302:1-9. doi: 10.1016/j.taap.2016.04.007. Epub 2016 Apr 16.
10 Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
11 Effect of the Catechol-O-Methyltransferase Inhibitors Tolcapone and Entacapone on Fatty Acid Metabolism in HepaRG Cells. Toxicol Sci. 2018 Aug 1;164(2):477-488.
12 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
13 Differential regulation of apolipoprotein B secretion from HepG2 cells by two HMG-CoA reductase inhibitors, atorvastatin and simvastatin. J Lipid Res. 1999 Jun;40(6):1078-89.
14 Cadmium induces triglyceride levels via microsomal triglyceride transfer protein (MTTP) accumulation caused by lysosomal deacidification regulated by endoplasmic reticulum (ER) Ca(2+) homeostasis. Chem Biol Interact. 2021 Oct 1;348:109649. doi: 10.1016/j.cbi.2021.109649. Epub 2021 Sep 10.
15 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
16 Inhibitory activity of diacylglycerol acyltransferase (DGAT) and microsomal triglyceride transfer protein (MTP) by the flavonoid, taxifolin, in HepG2 cells: potential role in the regulation of apolipoprotein B secretion. Atherosclerosis. 2004 Oct;176(2):247-53. doi: 10.1016/j.atherosclerosis.2004.05.020.
17 Downregulation of miR-192 causes hepatic steatosis and lipid accumulation by inducing SREBF1: Novel mechanism for bisphenol A-triggered non-alcoholic fatty liver disease. Biochim Biophys Acta Mol Cell Biol Lipids. 2017 Sep;1862(9):869-882. doi: 10.1016/j.bbalip.2017.05.001. Epub 2017 May 5.
18 Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.
19 Isosilybin regulates lipogenesis and fatty acid oxidation via the AMPK/SREBP-1c/PPAR pathway. Chem Biol Interact. 2022 Dec 1;368:110250. doi: 10.1016/j.cbi.2022.110250. Epub 2022 Nov 5.