Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUD01BK)

• DOT Name: DnaJ homolog subfamily B member 4 (DNAJB4)
• Synonyms: Heat shock 40 kDa protein 1 homolog; HSP40 homolog; Heat shock protein 40 homolog; Human liver DnaJ-like protein
• Gene Name: DNAJB4
• Related Disease:
  Breast cancer
  Breast carcinoma
  Lung adenocarcinoma
  Advanced cancer
  Carcinoma
  Congenital myopathy 21 with early respiratory failure
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Hereditary diffuse gastric adenocarcinoma
  Juvenile-onset Parkinson disease
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Metastatic malignant neoplasm
  Neoplasm
  Schizophrenia
  Ductal breast carcinoma in situ
  Gastric cancer
  Melanoma
  Non-small-cell lung cancer
  Psoriasis
  Rheumatoid arthritis
• UniProt ID: DNJB4_HUMAN
• Pfam ID: PF00226 ; PF01556
• Sequence:
  MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKK
  REIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGR
  DSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMK
  ISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDH
  PKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPF
  PKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS
• Function: Probable chaperone. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).
• Tissue Specificity: Expressed in heart, pancreas and skeletal muscle, and to a lesser extent in brain, placenta and liver.

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Definitive	Biomarker	[1]
Breast carcinoma	DIS2UE88	Definitive	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Definitive	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Carcinoma	DISH9F1N	Strong	Altered Expression	[4]
Congenital myopathy 21 with early respiratory failure	DISCGBF4	Strong	Autosomal recessive	[5]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Altered Expression	[4]
Juvenile-onset Parkinson disease	DISNT5BI	Strong	Genetic Variation	[7]
Lung cancer	DISCM4YA	Strong	Altered Expression	[8]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[2]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[9]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[6]
Neoplasm	DISZKGEW	Strong	Altered Expression	[10]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[11]
Ductal breast carcinoma in situ	DISLCJY7	Limited	Altered Expression	[10]
Gastric cancer	DISXGOUK	Limited	Biomarker	[10]
Melanoma	DIS1RRCY	Limited	Altered Expression	[12]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Altered Expression	[13]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[14]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[15]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of DnaJ homolog subfamily B member 4 (DNAJB4).	[16]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of DnaJ homolog subfamily B member 4 (DNAJB4).	[39]

47 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[18]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[19]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[20]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[22]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[23]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[24]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[25]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[26]
Marinol	DM70IK5	Approved	Marinol increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[27]
Selenium	DM25CGV	Approved	Selenium decreases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[28]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[27]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[29]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[26]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[31]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[32]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[33]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[34]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[33]
Lindane	DMB8CNL	Approved	Lindane increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[32]
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[35]
Clotrimazole	DMMFCIH	Approved	Clotrimazole increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[36]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[28]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[32]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[37]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[31]
Celastrol	DMWQIJX	Preclinical	Celastrol increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[38]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[40]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[41]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[42]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[43]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[32]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[44]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[31]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[45]
Farnesol	DMV2X1B	Investigative	Farnesol increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
NSC-1771	DMNXDGQ	Investigative	NSC-1771 increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[31]
BADGE	DMCK5DG	Investigative	BADGE increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
citral	DM53ZGY	Investigative	citral increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
1-DODECANOL	DM7P3N5	Investigative	1-DODECANOL increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
N-dodecylgallate	DMV5RZM	Investigative	N-dodecylgallate increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]
Abietic acid	DMW1Y2G	Investigative	Abietic acid increases the expression of DnaJ homolog subfamily B member 4 (DNAJB4).	[30]

References

• [1] Systems-level Analysis Reveals Multiple Modulators of Epithelial-mesenchymal Transition and Identifies DNAJB4 and CD81 as Novel Metastasis Inducers in Breast Cancer.Mol Cell Proteomics. 2019 Sep;18(9):1756-1771. doi: 10.1074/mcp.RA119.001446. Epub 2019 Jun 20.
• [2] Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
• [3] A Targeted Proteomic Approach for Heat Shock Proteins Reveals DNAJB4 as a Suppressor for Melanoma Metastasis.Anal Chem. 2018 Jun 5;90(11):6835-6842. doi: 10.1021/acs.analchem.8b00986. Epub 2018 May 11.
• [4] DNAJB4 molecular chaperone distinguishes WT from mutant E-cadherin, determining their fate in vitro and in vivo.Hum Mol Genet. 2014 Apr 15;23(8):2094-105. doi: 10.1093/hmg/ddt602. Epub 2013 Nov 29.
• [5] Loss of function variants in DNAJB4 cause a myopathy with early respiratory failure. Acta Neuropathol. 2023 Jan;145(1):127-143. doi: 10.1007/s00401-022-02510-8. Epub 2022 Oct 20.
• [6] Hepatitis B virus protein up-regulated HLJ1 expression via the transcription factor YY1 in human hepatocarcinoma cells.Virus Res. 2011 Apr;157(1):76-81. doi: 10.1016/j.virusres.2011.02.009. Epub 2011 Feb 21.
• [7] DNAJC6 promotes hepatocellular carcinoma progression through induction of epithelial-mesenchymal transition.Biochem Biophys Res Commun. 2014 Dec 12;455(3-4):298-304. doi: 10.1016/j.bbrc.2014.11.011. Epub 2014 Nov 13.
• [8] HLJ1 is an endogenous Src inhibitor suppressing cancer progression through dual mechanisms.Oncogene. 2016 Oct 27;35(43):5674-5685. doi: 10.1038/onc.2016.106. Epub 2016 Apr 11.
• [9] Curcumin inhibits lung cancer cell invasion and metastasis through the tumor suppressor HLJ1.Cancer Res. 2008 Sep 15;68(18):7428-38. doi: 10.1158/0008-5472.CAN-07-6734.
• [10] HLJ1 (DNAJB4) Gene Is a Novel Biomarker Candidate in Breast Cancer.OMICS. 2017 May;21(5):257-265. doi: 10.1089/omi.2017.0016.
• [11] Pleiotropic Meta-Analysis of Cognition, Education, and Schizophrenia Differentiates Roles of Early Neurodevelopmental and Adult Synaptic Pathways.Am J Hum Genet. 2019 Aug 1;105(2):334-350. doi: 10.1016/j.ajhg.2019.06.012.
• [12] Pulmonary administration of curcumin inhibits B16F10 melanoma lung metastasis and invasion in mice.Cancer Chemother Pharmacol. 2018 Aug;82(2):265-273. doi: 10.1007/s00280-018-3616-6. Epub 2018 Jun 4.
• [13] The HLJ1-targeting drug screening identified Chinese herb andrographolide that can suppress tumour growth and invasion in non-small-cell lung cancer.Carcinogenesis. 2013 May;34(5):1069-80. doi: 10.1093/carcin/bgt005. Epub 2013 Jan 9.
• [14] Large scale meta-analysis characterizes genetic architecture for common psoriasis associated variants.Nat Commun. 2017 May 24;8:15382. doi: 10.1038/ncomms15382.
• [15] Smoking induces transcription of the heat shock protein system in the joints.Ann Rheum Dis. 2014 Jul;73(7):1423-6. doi: 10.1136/annrheumdis-2013-204486. Epub 2014 Feb 18.
• [16] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [17] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [18] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [19] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [20] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [21] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [24] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [25] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [26] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [27] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [28] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [29] Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
• [30] An in vitro skin sensitization assay termed EpiSensA for broad sets of chemicals including lipophilic chemicals and pre/pro-haptens. Toxicol In Vitro. 2017 Apr;40:11-25. doi: 10.1016/j.tiv.2016.12.005. Epub 2016 Dec 10.
• [31] Development of a new in vitro skin sensitization assay (Epidermal Sensitization Assay; EpiSensA) using reconstructed human epidermis. Toxicol In Vitro. 2013 Dec;27(8):2213-24. doi: 10.1016/j.tiv.2013.08.007. Epub 2013 Aug 30.
• [32] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [33] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [34] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [35] The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
• [36] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [37] BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
• [38] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [39] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [40] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [41] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [42] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [43] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [44] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [45] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.