Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT27354E)

DOT Name Golgin subfamily A member 3 (GOLGA3)
Synonyms Golgi complex-associated protein of 170 kDa; GCP170; Golgin-160
Gene Name GOLGA3
Related Disease
Central nervous system neoplasm ( )
Glioma ( )
Werner syndrome ( )
UniProt ID
GOGA3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDGASAEQDGLQEDRSHSGPSSLPEAPLKPPGPLVPPDQQDKVQCAEVNRASTEGESPDG
PGQGGLCQNGPTPPFPDPPSSLDPTTSPVGPDASPGVAGFHDNLRKSQGTSAEGSVRKEA
LQSLRLSLPMQETQLCSTDSPLPLEKEEQVRLQARKWLEEQLKQYRVKRQQERSSQPATK
TRLFSTLDPELMLNPENLPRASTLAMTKEYSFLRTSVPRGPKVGSLGLPAHPREKKTSKS
SKIRSLADYRTEDSNAGNSGGNVPAPDSTKGSLKQNRSSAASVVSEISLSPDTDDRLENT
SLAGDSVSEVDGNDSDSSSYSSASTRGTYGILSKTVGTQDTPYMVNGQEIPADTLGQFPS
IKDVLQAAAAEHQDQGQEVNGEVRSRRDSICSSVSLESSAAETQEEMLQVLKEKMRLEGQ
LEALSLEASQALKEKAELQAQLAALSTKLQAQVECSHSSQQRQDSLSSEVDTLKQSCWDL
ERAMTDLQNMLEAKNASLASSNNDLQVAEEQYQRLMAKVEDMQRSMLSKDNTVHDLRQQM
TALQSQLQQVQLERTTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQ
VGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAAFMQIQ
EAKTMVEEDLQRRLEEFEGERERLQRMADSAASLEQQLEQVKLTLLQRDQQLEALQQEHL
DLMKQLTLTQEALQSREQSLDALQTHYDELQARLGELQGEAASREDTICLLQNEKIILEA
ALQAAKSGKEELDRGARRLEEGTEETSETLEKLREELAIKSGQVEHLQQETAALKKQMQK
IKEQFLQQKVMVEAYRRDATSKDQLISELKATRKRLDSELKELRQELMQVHGEKRTAEAE
LSRLHREVAQVRQHMADLEGHLQSAQKERDEMETHLQSLQFDKEQMVAVTEANEALKKQI
EELQQEARKAITEQKQKMRRLGSDLTSAQKEMKTKHKAYENAVGILSRRLQEALAAKEAA
DAELGQLRAQGGSSDSSLALHERIQALEAELQAVSHSKTLLEKELQEVIALTSQELEESR
EKVLELEDELQESRGFRKKIKRLEESNKKLALELEHEKGKLTGLGQSNAALREHNSILET
ALAKREADLVQLNLQVQAVLQRKEEEDRQMKHLVQALQASLEKEKEKVNSLKEQVAAAKV
EAGHNRRHFKAASLELSEVKKELQAKEHLVQKLQAEADDLQIREGKHSQEIAQFQAELAE
ARAQLQLLQKQLDEQLSKQPVGNQEMENLKWEVDQKEREIQSLKQQLDLTEQQGRKELEG
LQQLLQNVKSELEMAQEDLSMTQKDKFMLQAKVSELKNNMKTLLQQNQQLKLDLRRGAAK
TRKEPKGEASSSNPATPIKIPDCPVPASLLEELLRPPPAVSKEPLKNLNSCLQQLKQEMD
SLQRQMEEHALTVHESLSSWTPLEPATASPVPPGGHAGPRGDPQRHSQSRASKEGPGE
Function Golgi auto-antigen; probably involved in maintaining Golgi structure.
Tissue Specificity Expressed in all tissues tested. Expressed in liver, testis, lung, heart, salivary gland and kidney.
Reactome Pathway
RND2 GTPase cycle (R-HSA-9696270 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Central nervous system neoplasm DISFC18W Strong Genetic Variation [1]
Glioma DIS5RPEH Strong Genetic Variation [1]
Werner syndrome DISZY45W moderate Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Golgin subfamily A member 3 (GOLGA3). [3]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Golgin subfamily A member 3 (GOLGA3). [4]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Golgin subfamily A member 3 (GOLGA3). [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Golgin subfamily A member 3 (GOLGA3). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Golgin subfamily A member 3 (GOLGA3). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Golgin subfamily A member 3 (GOLGA3). [8]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Golgin subfamily A member 3 (GOLGA3). [10]
Selenium DM25CGV Approved Selenium increases the expression of Golgin subfamily A member 3 (GOLGA3). [11]
Menadione DMSJDTY Approved Menadione affects the expression of Golgin subfamily A member 3 (GOLGA3). [12]
Clozapine DMFC71L Approved Clozapine increases the expression of Golgin subfamily A member 3 (GOLGA3). [13]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Golgin subfamily A member 3 (GOLGA3). [11]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Golgin subfamily A member 3 (GOLGA3). [16]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Golgin subfamily A member 3 (GOLGA3). [18]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Golgin subfamily A member 3 (GOLGA3). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Golgin subfamily A member 3 (GOLGA3). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Golgin subfamily A member 3 (GOLGA3). [14]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Golgin subfamily A member 3 (GOLGA3). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Golgin subfamily A member 3 (GOLGA3). [17]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Golgin subfamily A member 3 (GOLGA3). [15]
------------------------------------------------------------------------------------

References

1 Genome-wide association study identifies multiple susceptibility loci for glioma.Nat Commun. 2015 Oct 1;6:8559. doi: 10.1038/ncomms9559.
2 Human cytomegalovirus UL97 kinase prevents the deposition of mutant protein aggregates in cellular models of Huntington's disease and ataxia.Neurobiol Dis. 2011 Jan;41(1):11-22. doi: 10.1016/j.nbd.2010.08.013. Epub 2010 Aug 20.
3 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
6 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
10 Identification of biomarkers for the initiation of apoptosis in human preneoplastic colonocytes by proteome analysis. Int J Cancer. 2004 Mar 20;109(2):220-9. doi: 10.1002/ijc.11692.
11 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
12 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
13 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
16 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
17 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
18 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
19 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.