Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4CL1EW)

DOT Name Cortactin-binding protein 2 (CTTNBP2)
Synonyms CortBP2
Gene Name CTTNBP2
Related Disease
Autism ( )
Genital herpes ( )
Juvenile idiopathic arthritis ( )
Major depressive disorder ( )
Myocardial ischemia ( )
Non-insulin dependent diabetes ( )
Adenocarcinoma ( )
Colorectal adenocarcinoma ( )
Hepatocellular carcinoma ( )
Autism spectrum disorder ( )
Kaposi sarcoma ( )
Neuroblastoma ( )
UniProt ID
CTTB2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00023 ; PF12796 ; PF13637 ; PF09727
Sequence
MATDGASCEPDLSRAPEDAAGAAAEAAKKEFDVDTLSKSELRMLLSVMEGELEARDLVIE
ALRARRKEVFIQERYGRFNLNDPFLALQRDYEAGAGDKEKKPVCTNPLSILEAVMAHCKK
MQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKQVVLMLVKECKQ
LSGKVIEEAQKLEDVMAKLEEEKKKTNELEEELSAEKRRSTEMEAQMEKQLSEFDTEREQ
LRAKLNREEAHTTDLKEEIDKMRKMIEQLKRGSDSKPSLSLPRKTKDRRLVSISVGTEGT
VTRSVACQTDLVTENADHMKKLPLTMPVKPSTGSPLVSANAKGSVCTSATMARPGIDRQA
SYGDLIGASVPAFPPPSANKIEENGPSTGSTPDPTSSTPPLPSNAAPPTAQTPGIAPQNS
QAPPMHSLHSPCANTSLHPGLNPRIQAARFRFQGNANDPDQNGNTTQSPPSRDVSPTSRD
NLVAKQLARNTVTQALSRFTSPQAGAPSRPGVPPTGDVGTHPPVGRTSLKTHGVARVDRG
NPPPIPPKKPGLSQTPSPPHPQLKVIIDSSRASNTGAKVDNKTVASTPSSLPQGNRVINE
ENLPKSSSPQLPPKPSIDLTVAPAGCAVSALATSQVGAWPAATPGLNQPACSDSSLVIPT
TIAFCSSINPVSASSCRPGASDSLLVTASGWSPSLTPLLMSGGPAPLAGRPTLLQQAAAQ
GNVTLLSMLLNEEGLDINYSCEDGHSALYSAAKNGHTDCVRLLLSAEAQVNAADKNGFTP
LCAAAAQGHFECVELLISYDANINHAADGGQTPLYLACKNGNKECIKLLLEAGTNRSVKT
TDGWTPVHAAVDTGNVDSLKLLMYHRIPAHGNSFNEEESESSVFDLDGGEESPEGISKPV
VPADLINHANREGWTAAHIAASKGFKNCLEILCRHGGLEPERRDKCNRTVHDVATDDCKH
LLENLNALKIPLRISVGEIEPSNYGSDDLECENTICALNIRKQTSWDDFSKAVSQALTNH
FQAISSDGWWSLEDVTCNNTTDSNIGLSARSIRSITLGNVPWSVGQSFAQSPWDFMRKNK
AEHITVLLSGPQEGCLSSVTYASMIPLQMMQNYLRLVEQYHNVIFHGPEGSLQDYIVHQL
ALCLKHRQMAAGFSCEIVRAEVDAGFSKEQLLDLFISSACLIPVKQSPSKKKIIIILENL
EKSSLSELLRDFLAPLENRSTESPCTFQKGNGLSECYYFHENCFLMGTIAKACLQGSDLL
VQQHFRWVQLRWDGEPMQGLLQRFLRRKVVNKFKGQAPSPCDPVCKIVDWALSVWRQLNS
CLARLGTPEALLGPKYFLSCPVVPGHAQVTVKWMSKLWNGVIAPRVQEAILSRASVKRQP
GFGQTTAKRHPSQGQQAVVKAALSILLNKAVLHGCPLPRAELDQHTADFKGGSFPLSIVS
SYNTCNKKKGESGAWRKVNTSPRRKSGRFSLPTWNKPDLSTEGMKNKTISQLNCNRNASL
SKQKSLENDLSLTLNLDQRLSLGSDDEADLVKELQSMCSSKSESDISKIADSRDDLRMFD
SSGNNPVLSATINNLRMPVSQKEVSPLSSHQTTECSNSKSKTELGVSRVKSFLPVPRSKV
TQCSQNTKRSSSSSNTRQIEINNNSKEVNWNLHKNEHLEKPNK
Function Regulates the dendritic spine distribution of CTTN/cortactin in hippocampal neurons, thus controls dendritic spinogenesis and dendritic spine maintenance.
Tissue Specificity Highest expression in brain. Also expressed in kidney, pancreas, lung, heart, liver, skeletal muscle and placenta.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autism DISV4V1Z Strong Biomarker [1]
Genital herpes DISAP666 Strong Biomarker [2]
Juvenile idiopathic arthritis DISQZGBV Strong Genetic Variation [3]
Major depressive disorder DIS4CL3X Strong Genetic Variation [4]
Myocardial ischemia DISFTVXF Strong Biomarker [5]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [6]
Adenocarcinoma DIS3IHTY moderate Biomarker [7]
Colorectal adenocarcinoma DISPQOUB moderate Altered Expression [7]
Hepatocellular carcinoma DIS0J828 moderate Biomarker [8]
Autism spectrum disorder DISXK8NV Limited Autosomal dominant [9]
Kaposi sarcoma DISC1H1Z Limited Biomarker [10]
Neuroblastoma DISVZBI4 Limited Altered Expression [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [12]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [13]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [14]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [15]
Phenobarbital DMXZOCG Approved Phenobarbital decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [16]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [17]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [19]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Cortactin-binding protein 2 (CTTNBP2). [20]
PMID27336223-Compound-5 DM6E50A Patented PMID27336223-Compound-5 decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [17]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Cortactin-binding protein 2 (CTTNBP2). [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Cortactin-binding protein 2 (CTTNBP2). [18]
------------------------------------------------------------------------------------

References

1 Identification of the human cortactin-binding protein-2 gene from the autism candidate region at 7q31.Genomics. 2001 Nov;78(1-2):7-11. doi: 10.1006/geno.2001.6651.
2 Granzyme B Cleaves Multiple Herpes Simplex Virus 1 and Varicella-Zoster Virus (VZV) Gene Products, and VZV ORF4 Inhibits Natural Killer Cell Cytotoxicity.J Virol. 2019 Oct 29;93(22):e01140-19. doi: 10.1128/JVI.01140-19. Print 2019 Nov 15.
3 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.Pharmacogenomics J. 2014 Aug;14(4):356-64. doi: 10.1038/tpj.2014.3. Epub 2014 Apr 8.
4 Genome-wide meta-analysis of depression identifies 102 independent variants and highlights the importance of the prefrontal brain regions.Nat Neurosci. 2019 Mar;22(3):343-352. doi: 10.1038/s41593-018-0326-7. Epub 2019 Feb 4.
5 Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
6 Genome-wide association analyses identify 143 risk variants and putative regulatory mechanisms for type 2 diabetes.Nat Commun. 2018 Jul 27;9(1):2941. doi: 10.1038/s41467-018-04951-w.
7 Low expression of ORF4, a dominant negative variant of peroxisome proliferator-activated receptor gamma, in colorectal adenocarcinoma.Oncol Rep. 2007 Aug;18(2):489-95.
8 Zinc Salts Block Hepatitis E Virus Replication by Inhibiting the Activity of Viral RNA-Dependent RNA Polymerase.J Virol. 2017 Oct 13;91(21):e00754-17. doi: 10.1128/JVI.00754-17. Print 2017 Nov 1.
9 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
10 Complement regulation by Kaposi's sarcoma-associated herpesvirus ORF4 protein.J Virol. 2003 Jan;77(1):592-9. doi: 10.1128/jvi.77.1.592-599.2003.
11 Integrating evolutionary and regulatory information with a multispecies approach implicates genes and pathways in obsessive-compulsive disorder.Nat Commun. 2017 Oct 17;8(1):774. doi: 10.1038/s41467-017-00831-x.
12 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
13 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
14 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
15 Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
16 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
17 PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
18 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
19 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
20 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
21 An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.