General Information of Drug Off-Target (DOT) (ID: OT5RPQRE)

DOT Name Protein FAM43A (FAM43A)
Gene Name FAM43A
Related Disease
Autism ( )
UniProt ID
FA43A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14719
Sequence
MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKK
LHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRM
VHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEK
AQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHTIPLVPLRKLLLHGPCCYKPP
VERSRSAPKLGSITEDLLGEQLEQELQEEEEEEQPEGCPEEEENRAAEGDPAEEEAEAQR
ALVVAMHFECGDLLDTLENGRGEALGGGGGSLGPGAGPPPLLLGSASDMKAELSQLISDL
GELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP
HSG

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autism DISV4V1Z Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
34 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Protein FAM43A (FAM43A). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein FAM43A (FAM43A). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Protein FAM43A (FAM43A). [4]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Protein FAM43A (FAM43A). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Protein FAM43A (FAM43A). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Protein FAM43A (FAM43A). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein FAM43A (FAM43A). [8]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Protein FAM43A (FAM43A). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Protein FAM43A (FAM43A). [10]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Protein FAM43A (FAM43A). [11]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Protein FAM43A (FAM43A). [12]
Progesterone DMUY35B Approved Progesterone decreases the expression of Protein FAM43A (FAM43A). [13]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Protein FAM43A (FAM43A). [14]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Protein FAM43A (FAM43A). [15]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Protein FAM43A (FAM43A). [16]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Protein FAM43A (FAM43A). [17]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Protein FAM43A (FAM43A). [18]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Protein FAM43A (FAM43A). [19]
Pantothenic acid DM091H2 Approved Pantothenic acid increases the expression of Protein FAM43A (FAM43A). [20]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Protein FAM43A (FAM43A). [21]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Protein FAM43A (FAM43A). [14]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Protein FAM43A (FAM43A). [8]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Protein FAM43A (FAM43A). [22]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Protein FAM43A (FAM43A). [14]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Protein FAM43A (FAM43A). [24]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Protein FAM43A (FAM43A). [25]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Protein FAM43A (FAM43A). [26]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protein FAM43A (FAM43A). [27]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Protein FAM43A (FAM43A). [28]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Protein FAM43A (FAM43A). [29]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Protein FAM43A (FAM43A). [8]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Protein FAM43A (FAM43A). [30]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Protein FAM43A (FAM43A). [31]
QUERCITRIN DM1DH96 Investigative QUERCITRIN increases the expression of Protein FAM43A (FAM43A). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 34 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Protein FAM43A (FAM43A). [23]
------------------------------------------------------------------------------------

References

1 A genome wide association study of mathematical ability reveals an association at chromosome 3q29, a locus associated with autism and learning difficulties: a preliminary study.PLoS One. 2014 May 6;9(5):e96374. doi: 10.1371/journal.pone.0096374. eCollection 2014.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
9 Transcriptomics and methylomics of CD4-positive T cells in arsenic-exposed women. Arch Toxicol. 2017 May;91(5):2067-2078. doi: 10.1007/s00204-016-1879-4. Epub 2016 Nov 12.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
12 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
13 Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
14 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
15 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
16 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
17 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
18 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
19 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
20 Calcium pantothenate modulates gene expression in proliferating human dermal fibroblasts. Exp Dermatol. 2009 Nov;18(11):969-78. doi: 10.1111/j.1600-0625.2009.00884.x. Epub 2009 Apr 8.
21 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
22 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
23 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
24 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
25 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
26 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
27 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
28 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
29 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
30 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
31 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
32 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.