Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6SK923)

• DOT Name: Spermatogenesis-associated protein 17 (SPATA17)
• Gene Name: SPATA17
• Related Disease: Azoospermia
• UniProt ID: SPT17_HUMAN
• Pfam ID: PF00612
• Sequence:
  MATLARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRHLNRIVT
  IIQKWWRSFLGRKQYQLTVQVAYYTMMMNLYNAMAVRIQRRWRGYRVRKYLFNYYYLKEY
  LKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDYQARKMHYLLSTKQIPGIYNS
  PFRKEPDPWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACTSARSFPRSEILPPINRKQC
  QGPFRDITEVLEQRYRPLEPTLRVAEPIDELKLAREELRREEWLQNVNDNMFLPFSSYHK
  NEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQTVLPSFELFSKYGKLYSKAGQI
  V

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Azoospermia	DIS94181	Strong	Genetic Variation	[1]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[5]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Spermatogenesis-associated protein 17 (SPATA17).	[6]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[7]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[7]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[8]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[10]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Spermatogenesis-associated protein 17 (SPATA17).	[11]

References

• [1] A single nucleotide polymorphism in SPATA17 may be a genetic risk factor for Japanese patients with meiotic arrest.Asian J Androl. 2009 Sep;11(5):623-8. doi: 10.1038/aja.2009.30. Epub 2009 Jun 1.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [8] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [9] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [10] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
• [11] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.