Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8BXS5U)

• DOT Name: Transcription elongation factor 1 homolog (ELOF1)
• Gene Name: ELOF1
• Related Disease:
  Cervical cancer
  Cervical carcinoma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Chronic granulomatous disease
  Endometrial carcinoma
  Lupus
  Retinoblastoma
  Systemic lupus erythematosus
  Acute myelogenous leukaemia
  Nasopharyngeal carcinoma
  Neoplasm
• UniProt ID: ELOF1_HUMAN
• Pfam ID: PF05129
• Sequence:
  MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTP
  ITYLSEPVDVYSDWIDACEAANQ
• Function: Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cervical cancer	DISFSHPF	Definitive	Altered Expression	[1]
Cervical carcinoma	DIST4S00	Definitive	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Chronic granulomatous disease	DIS9ZR24	Strong	Genetic Variation	[3]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[4]
Lupus	DISOKJWA	Strong	Biomarker	[5]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[1]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[5]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[6]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[7]
Neoplasm	DISZKGEW	Limited	Altered Expression	[8]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transcription elongation factor 1 homolog (ELOF1).	[9]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Transcription elongation factor 1 homolog (ELOF1).	[10]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcription elongation factor 1 homolog (ELOF1).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transcription elongation factor 1 homolog (ELOF1).	[13]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Transcription elongation factor 1 homolog (ELOF1).	[14]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Transcription elongation factor 1 homolog (ELOF1).	[15]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Transcription elongation factor 1 homolog (ELOF1).	[12]

References

• [1] Human papilloma virus (HPV) E7-mediated attenuation of retinoblastoma (Rb) induces hPygopus2 expression via Elf-1 in cervical cancer.Mol Cancer Res. 2013 Jan;11(1):19-30. doi: 10.1158/1541-7786.MCR-12-0510. Epub 2013 Jan 2.
• [2] Protein expression of the Ets transcription factor Elf-1 in breast cancer cells is negatively correlated with histological grading, but not with clinical outcome.Oncol Rep. 2011 Nov;26(5):1121-5. doi: 10.3892/or.2011.1409. Epub 2011 Aug 2.
• [3] Elf-1 and PU.1 induce expression of gp91(phox) via a promoter element mutated in a subset of chronic granulomatous disease patients.Blood. 1999 May 15;93(10):3512-20.
• [4] The relationship between oncogene expression and clinical outcome in endometrial carcinoma.Curr Cancer Drug Targets. 2004 Sep;4(6):511-20. doi: 10.2174/1568009043332871.
• [5] PP2A dephosphorylates Elf-1 and determines the expression of CD3zeta and FcRgamma in human systemic lupus erythematosus T cells.J Immunol. 2008 Sep 1;181(5):3658-64. doi: 10.4049/jimmunol.181.5.3658.
• [6] The level of MEF but not ELF-1 correlates with FAB subtype of acute myeloid leukemia and is low in good prognosis cases.Leuk Res. 2003 May;27(5):387-92. doi: 10.1016/s0145-2126(02)00214-x.
• [7] ELF-1 expression in nasopharyngeal carcinoma facilitates proliferation and metastasis of cancer cells via modulation of CCL2/CCR2 signaling.Cancer Manag Res. 2019 Jun 6;11:5243-5254. doi: 10.2147/CMAR.S196355. eCollection 2019.
• [8] Ets protein Elf-1 bidirectionally suppresses transcriptional activities of the tumor suppressor Tsc2 gene and the repair-related Nth1 gene.Mol Carcinog. 2003 Jul;37(3):122-9. doi: 10.1002/mc.10123.
• [9] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [10] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [11] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [12] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [13] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [14] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [15] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.