Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCVZRG6)

• DOT Name: Codanin-1 (CDAN1)
• Gene Name: CDAN1
• Related Disease:
  Anemia, congenital dyserythropoietic, type 1a
  Diabetic kidney disease
  Mycoses
  Neonatal anemia
  Renal fibrosis
  Alpha thalassemia
  Ankylosing spondylitis
  Congenital anemia
  Granular corneal dystrophy type II
  Hemoglobin H disease
  Hereditary haemolytic anemia
  Inflammatory bowel disease
  Irritable bowel syndrome
  Knee osteoarthritis
  Late-onset Parkinson disease
  Noonan syndrome
  Obesity
  Psoriatic arthritis
  Rheumatoid arthritis
  Syndactyly
  Thrombocytopenia
  Ulcerative colitis
  Unilateral multicystic dysplastic kidney
  Leukopenia
  Congenital dyserythropoietic anemia type 1
  Arrhythmia
  Bipolar disorder
  Congenital dyserythropoietic anemia
  Crohn disease
  Oral mucositis
• UniProt ID: CDAN1_HUMAN
• Pfam ID: PF15296
• Sequence:
  MAAVLESLLREEVSVAAVVRWIARSTQGSEDNAGEAAALSSLRALRKEFVPFLLNFLREQ
  SSRVLPQGPPTPAKTPGASAALPGRPGGPPRGSRGARSQLFPPTEAQSTAAEAPLARRGG
  RRRGPGPARERGGRGLEEGVSGESLPGAGGRRLRGSGSPSRPSLTLSDPPNLSNLEEFPP
  VGSVPPGPTGTKPSRRINPTPVSEERSLSKPKTCFTSPPISCVPSSQPSALDTSPWGLGL
  PPGCRSLQEEREMLRKERSKQLQQSPTPTCPTPELGSPLPSRTGSLTDEPADPARVSSRQ
  RLELVALVYSSCIAENLVPNLFLELFFVFQLLTARRMVTAKDSDPELSPAVLDSLESPLF
  QSIHDCVFFAVQVLECHFQVLSNLDKGTLKLLAENERLLCFSPALQGRLRAAYEGSVAKV
  SLVMPPSTQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPGWDFEKG
  LGSRIRAMMGQLSAACSHSHFVRLFQKQLLQMCQSPGGAGGTVLGEAPDVLSMLGADKLG
  RLWRLQERLMAPQSSGGPCPPPTFPGCQGFFRDFILSASSFQFNQHLMDSLSLKIQELNG
  LALPQHEPNDEDGESDVDWQGERKQFAVVLLSLRLLAKFLGFVAFLPYRGPEPPPTGELQ
  DSILALRSQVPPVLDVRTLLQRGLQARRAVLTVPWLVEFLSFADHVVPLLEYYRDIFTLL
  LRLHRSLVLSQESEGKMCFLNKLLLLAVLGWLFQIPTVPEDLFFLEEGPSYAFEVDTVAP
  EHGLDNAPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFMRKITPTTTTSLGAQPS
  QTSQGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQEQ
  LVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSS
  AENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGCSRACEHH
  APLPSHLISEIKDVLSLAVGPRDPDEGVSPEHLEQLLGQLGQTLRCRQFLCPPAEQHLAK
  CSVELASLLVADQIPILGPPAQYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNV
  GLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFL
  AEPHLPEPQLRACELVQPNRGTVLAQS
• Function: May act as a negative regulator of ASF1 in chromatin assembly.
• Tissue Specificity: Ubiquitously expressed. Isoform 3 is not found in erythroid cells.

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anemia, congenital dyserythropoietic, type 1a	DISJZNT8	Definitive	Autosomal recessive	[1]
Diabetic kidney disease	DISJMWEY	Definitive	Biomarker	[2]
Mycoses	DIS9K7PB	Definitive	Biomarker	[3]
Neonatal anemia	DISPFC78	Definitive	Biomarker	[4]
Renal fibrosis	DISMHI3I	Definitive	Biomarker	[2]
Alpha thalassemia	DIS5XGK0	Strong	Altered Expression	[5]
Ankylosing spondylitis	DISRC6IR	Strong	Altered Expression	[6]
Congenital anemia	DISTW0J6	Strong	Biomarker	[5]
Granular corneal dystrophy type II	DISAEE20	Strong	Genetic Variation	[7]
Hemoglobin H disease	DISHFWO5	Strong	Altered Expression	[5]
Hereditary haemolytic anemia	DIS487SI	Strong	Genetic Variation	[8]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[6]
Irritable bowel syndrome	DIS27206	Strong	Biomarker	[6]
Knee osteoarthritis	DISLSNBJ	Strong	Altered Expression	[9]
Late-onset Parkinson disease	DIS9IOUI	Strong	Biomarker	[10]
Noonan syndrome	DIS7Q7DN	Strong	Genetic Variation	[11]
Obesity	DIS47Y1K	Strong	Genetic Variation	[12]
Psoriatic arthritis	DISLWTG2	Strong	Biomarker	[13]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[14]
Syndactyly	DISZK2BT	Strong	Genetic Variation	[15]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[16]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[17]
Unilateral multicystic dysplastic kidney	DISUYQ0C	Strong	Genetic Variation	[18]
Leukopenia	DISJMBMM	moderate	Biomarker	[19]
Congenital dyserythropoietic anemia type 1	DISCBVO6	Supportive	Autosomal recessive	[20]
Arrhythmia	DISFF2NI	Limited	Biomarker	[21]
Bipolar disorder	DISAM7J2	Limited	Genetic Variation	[22]
Congenital dyserythropoietic anemia	DIS6FAT6	Limited	Autosomal recessive	[23]
Crohn disease	DIS2C5Q8	Limited	Altered Expression	[24]
Oral mucositis	DISS93V5	Limited	Biomarker	[25]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Codanin-1 (CDAN1).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Codanin-1 (CDAN1).	[27]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Codanin-1 (CDAN1).	[28]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Codanin-1 (CDAN1).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Codanin-1 (CDAN1).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Codanin-1 (CDAN1).	[33]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Codanin-1 (CDAN1).	[34]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Codanin-1 (CDAN1).	[29]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Codanin-1 (CDAN1).	[32]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Targeting the CDA1/CDA1BP1 Axis Retards Renal Fibrosis in Experimental Diabetic Nephropathy.Diabetes. 2019 Feb;68(2):395-408. doi: 10.2337/db18-0712. Epub 2018 Nov 13.
• [3] Cryptococcus neoformans Cda1 and Its Chitin Deacetylase Activity Are Required for Fungal Pathogenesis.mBio. 2018 Nov 20;9(6):e02087-18. doi: 10.1128/mBio.02087-18.
• [4] Neonatal manifestations of congenital dyserythropoietic anemia type I.J Pediatr. 1997 Jul;131(1 Pt 1):95-7. doi: 10.1016/s0022-3476(97)70130-6.
• [5] A novel case of haemoglobin H disease associated with clinical and morphological characteristics of congenital dyserythropoietic anaemia type I.Eur J Haematol. 2002 Apr;68(4):247-52. doi: 10.1034/j.1600-0609.2002.01590.x.
• [6] The appearance of joint manifestations in the Swiss inflammatory bowel disease cohort.PLoS One. 2019 Apr 30;14(4):e0211554. doi: 10.1371/journal.pone.0211554. eCollection 2019.
• [7] Congenital dyserythropoietic anemia type I is caused by mutations in codanin-1. Am J Hum Genet. 2002 Dec;71(6):1467-74. doi: 10.1086/344781. Epub 2002 Nov 14.
• [8] Congenital dyserythropoietic anemia type 1 with a novel mutation in the CDAN1 gene previously diagnosed as congenital hemolytic anemia.Int J Hematol. 2013 May;97(5):650-3. doi: 10.1007/s12185-013-1338-4. Epub 2013 Apr 19.
• [9] Rheumatoid Arthritis Flares After Total Hip and Total Knee Arthroplasty: Outcomes at One Year.Arthritis Care Res (Hoboken). 2020 Jul;72(7):925-932. doi: 10.1002/acr.24091. Epub 2020 May 14.
• [10] Musculoskeletal ultrasound as a biomarker of remission - results from a one-year prospective study in patients with rheumatoid arthritis.Med Ultrason. 2018 Dec 8;20(4):453-460. doi: 10.11152/mu-1609.
• [11] Unusual dysmorphic features in five patients with Noonan's syndrome: a brief review.J Paediatr Child Health. 2002 Oct;38(5):521-5. doi: 10.1046/j.1440-1754.2002.00027.x.
• [12] Influence of obesity, age, and comorbidities on the multi-biomarker disease activity test in rheumatoid arthritis.Semin Arthritis Rheum. 2018 Feb;47(4):472-477. doi: 10.1016/j.semarthrit.2017.07.010. Epub 2017 Aug 2.
• [13] Discordance between tender and swollen joint count as well as patient's and evaluator's global assessment may reduce likelihood of remission in patients with rheumatoid arthritis and psoriatic arthritis: data from the prospective multicentre NOR-DMARD study.Ann Rheum Dis. 2017 Apr;76(4):708-711. doi: 10.1136/annrheumdis-2016-210283. Epub 2016 Oct 4.
• [14] Comparative effectiveness of TNF inhibitors and tocilizumab with and without conventional synthetic disease-modifying antirheumatic drugs in a pan-European observational cohort of bio-nave patients with rheumatoid arthritis.Semin Arthritis Rheum. 2020 Feb;50(1):17-24. doi: 10.1016/j.semarthrit.2019.06.020. Epub 2019 Jun 28.
• [15] Congenital dyserythropoietic anemia in a Chinese family with a mutation of the CDAN1-gene.Ann Hematol. 2008 Sep;87(9):751-4. doi: 10.1007/s00277-008-0519-3. Epub 2008 Jun 25.
• [16] Alpha Particle Radium 223 Dichloride in High-risk Osteosarcoma: A Phase I Dose Escalation Trial.Clin Cancer Res. 2019 Jul 1;25(13):3802-3810. doi: 10.1158/1078-0432.CCR-18-3964. Epub 2019 Feb 7.
• [17] Efficacy of noninvasive evaluations in monitoring inflammatory bowel disease activity: A prospective study in China.World J Gastroenterol. 2017 Dec 14;23(46):8235-8247. doi: 10.3748/wjg.v23.i46.8235.
• [18] Dyserythropoiesis in a child with pyruvate kinase deficiency and coexistent unilateral multicystic dysplastic kidney.Pediatr Blood Cancer. 2014 Aug;61(8):1463-5. doi: 10.1002/pbc.24953. Epub 2014 Jan 30.
• [19] A phase I dose-escalation study of selumetinib in combination with docetaxel or dacarbazine in patients with advanced solid tumors.BMC Cancer. 2017 Mar 6;17(1):173. doi: 10.1186/s12885-017-3143-6.
• [20] Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
• [21] Protective Effects of Danlou Tablet () against Murine Myocardial Ischemia and Reperfusion Injury In Vivo.Chin J Integr Med. 2018 Aug;24(8):613-620. doi: 10.1007/s11655-016-2448-7. Epub 2016 Mar 21.
• [22] Genome-wide association study identifies 30 loci associated with bipolar disorder.Nat Genet. 2019 May;51(5):793-803. doi: 10.1038/s41588-019-0397-8. Epub 2019 May 1.
• [23] PanelApp crowdsources expert knowledge to establish consensus diagnostic gene panels. Nat Genet. 2019 Nov;51(11):1560-1565. doi: 10.1038/s41588-019-0528-2.
• [24] Treatment sequence network meta-analysis in Crohn's disease: a methodological case study.Curr Med Res Opin. 2019 May;35(5):733-756. doi: 10.1080/03007995.2019.1580094. Epub 2019 Mar 20.
• [25] Phase I study of resminostat, an HDAC inhibitor, combined with S-1 in patients with pre-treated biliary tract or pancreatic cancer.Invest New Drugs. 2019 Feb;37(1):109-117. doi: 10.1007/s10637-018-0634-5. Epub 2018 Jul 11.
• [26] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [29] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [30] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [31] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [32] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [33] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [34] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.