Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGEGAOK)

• DOT Name: High mobility group protein B2 (HMGB2)
• Synonyms: High mobility group protein 2; HMG-2
• Gene Name: HMGB2
• UniProt ID: HMGB2_HUMAN
• Pfam ID: PF00505 ; PF09011
• Sequence:
  MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
  EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
  SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
  SKKKNEPEDEEEEEEEEDEDEEEEDEDEE
• Function: Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity. Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Proposed to be involved in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor which cooperates with subsequent discriminative sensing by specific pattern recognition receptors. In the extracellular compartment acts as a chemokine. Promotes proliferation and migration of endothelial cells implicating AGER/RAGE. Has antimicrobial activity in gastrointestinal epithelial tissues. Involved in inflammatory response to antigenic stimulus coupled with pro-inflammatory activity. Involved in modulation of neurogenesis probably by regulation of neural stem proliferation. Involved in articular cartilage surface maintenance implicating LEF1 and the Wnt/beta-catenin pathway.
• Tissue Specificity: Expressed in gastric and intestinal tissues (at protein level).
• Reactome Pathway: Apoptosis induced DNA fragmentation (R-HSA-140342)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	High mobility group protein B2 (HMGB2) affects the response to substance of Topotecan.	[35]
Vinblastine	DM5TVS3	Approved	High mobility group protein B2 (HMGB2) affects the response to substance of Vinblastine.	[35]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of High mobility group protein B2 (HMGB2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of High mobility group protein B2 (HMGB2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of High mobility group protein B2 (HMGB2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of High mobility group protein B2 (HMGB2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of High mobility group protein B2 (HMGB2).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of High mobility group protein B2 (HMGB2).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of High mobility group protein B2 (HMGB2).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of High mobility group protein B2 (HMGB2).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of High mobility group protein B2 (HMGB2).	[9]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of High mobility group protein B2 (HMGB2).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of High mobility group protein B2 (HMGB2).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of High mobility group protein B2 (HMGB2).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of High mobility group protein B2 (HMGB2).	[13]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of High mobility group protein B2 (HMGB2).	[13]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of High mobility group protein B2 (HMGB2).	[7]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of High mobility group protein B2 (HMGB2).	[14]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of High mobility group protein B2 (HMGB2).	[15]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of High mobility group protein B2 (HMGB2).	[16]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of High mobility group protein B2 (HMGB2).	[17]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of High mobility group protein B2 (HMGB2).	[18]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of High mobility group protein B2 (HMGB2).	[19]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of High mobility group protein B2 (HMGB2).	[20]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of High mobility group protein B2 (HMGB2).	[21]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of High mobility group protein B2 (HMGB2).	[22]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide decreases the expression of High mobility group protein B2 (HMGB2).	[23]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of High mobility group protein B2 (HMGB2).	[24]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of High mobility group protein B2 (HMGB2).	[25]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of High mobility group protein B2 (HMGB2).	[2]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of High mobility group protein B2 (HMGB2).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of High mobility group protein B2 (HMGB2).	[27]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of High mobility group protein B2 (HMGB2).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of High mobility group protein B2 (HMGB2).	[29]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of High mobility group protein B2 (HMGB2).	[30]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of High mobility group protein B2 (HMGB2).	[31]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of High mobility group protein B2 (HMGB2).	[32]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of High mobility group protein B2 (HMGB2).	[33]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of High mobility group protein B2 (HMGB2).	[34]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of High mobility group protein B2 (HMGB2).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [3] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [8] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [11] [Construction of subtracted cDNA library in human Jurkat T cell line induced by arsenic trioxide in vitro]. Zhonghua Yu Fang Yi Xue Za Zhi. 2003 Nov;37(6):403-7.
• [12] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [13] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [14] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [15] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [16] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [17] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [18] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [19] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [20] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [21] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [22] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [23] Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
• [24] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [25] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [26] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [27] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [28] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [29] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [30] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [31] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [32] Transcriptomic alterations induced by Ochratoxin A in rat and human renal proximal tubular in vitro models and comparison to a rat in vivo model. Arch Toxicol. 2012 Apr;86(4):571-89.
• [33] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [34] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [35] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.