Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHEVZS6)

• DOT Name: Ras-like protein family member 11B (RASL11B)
• Synonyms: EC 3.6.5.2
• Gene Name: RASL11B
• Related Disease:
  Arteriosclerosis
  Clear cell renal carcinoma
  Neuroblastoma
• UniProt ID: RSLBB_HUMAN
• EC Number: 3.6.5.2
• Pfam ID: PF00071
• Sequence:
  MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIG
  DYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSI
  TDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYE
  VSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSA
  KVRTVTSV
• Tissue Specificity: Widely expressed with highest levels in placenta and primary macrophages.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[1]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[2]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[3]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ras-like protein family member 11B (RASL11B).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ras-like protein family member 11B (RASL11B).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Ras-like protein family member 11B (RASL11B).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Ras-like protein family member 11B (RASL11B).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Ras-like protein family member 11B (RASL11B).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Ras-like protein family member 11B (RASL11B).	[9]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Ras-like protein family member 11B (RASL11B).	[8]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Ras-like protein family member 11B (RASL11B).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Ras-like protein family member 11B (RASL11B).	[7]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Ras-like protein family member 11B (RASL11B).	[11]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Ras-like protein family member 11B (RASL11B).	[12]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Ras-like protein family member 11B (RASL11B).	[13]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Ras-like protein family member 11B (RASL11B).	[14]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ras-like protein family member 11B (RASL11B).	[9]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Ras-like protein family member 11B (RASL11B).	[15]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Ras-like protein family member 11B (RASL11B).	[17]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ras-like protein family member 11B (RASL11B).	[18]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ras-like protein family member 11B (RASL11B).	[16]

References

• [1] Cloning, genomic organization, and tissue-specific expression of the RASL11B gene.Biochim Biophys Acta. 2007 Jul-Aug;1769(7-8):514-24. doi: 10.1016/j.bbaexp.2007.05.005. Epub 2007 Jun 6.
• [2] Study on the mechanism behind lncRNA MEG3 affecting clear cell renal cell carcinoma by regulating miR-7/RASL11B signaling.J Cell Physiol. 2018 Dec;233(12):9503-9515. doi: 10.1002/jcp.26849. Epub 2018 Jul 3.
• [3] Upregulation of MAPK10, TUBB2B and RASL11B may contribute to the development of neuroblastoma.Mol Med Rep. 2019 Oct;20(4):3475-3486. doi: 10.3892/mmr.2019.10589. Epub 2019 Aug 20.
• [4] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [5] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [8] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [11] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [12] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [13] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [14] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [15] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [16] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [17] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [18] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.