Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHFKSIZ)

DOT Name Actin-related protein T1 (ACTRT1)
Synonyms ARP-T1
Gene Name ACTRT1
Related Disease
Amyloidosis ( )
Cardiovascular disease ( )
Cholangiocarcinoma ( )
Colorectal carcinoma ( )
Esophageal squamous cell carcinoma ( )
Inflammatory bowel disease ( )
Lung cancer ( )
Lung carcinoma ( )
Ocular melanoma ( )
Atherosclerosis ( )
Breast cancer ( )
Breast carcinoma ( )
Melanoma ( )
Arteriosclerosis ( )
UniProt ID
ACTT1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00022
Sequence
MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQE
ALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIRE
KLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTK
LCMAGRDITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKELRKSRGEVLGA
YRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIVL
SGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVTS
ADFKEYGTSVVQRRCF
Function Negatively regulates the Hedgehog (SHH) signaling. Binds to the promoter of the SHH signaling mediator, GLI1, and inhibits its expression.
Tissue Specificity In skin, expressed in the basal, spinous and granular layers of the epidermis. Also expressed in hair follicles, sebaceaous glands, eccrine sweat glands and semen.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Amyloidosis DISHTAI2 Strong Genetic Variation [1]
Cardiovascular disease DIS2IQDX Strong Biomarker [2]
Cholangiocarcinoma DIS71F6X Strong Biomarker [3]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [4]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [5]
Inflammatory bowel disease DISGN23E Strong Biomarker [4]
Lung cancer DISCM4YA Strong Genetic Variation [6]
Lung carcinoma DISTR26C Strong Genetic Variation [6]
Ocular melanoma DISOHHFC Strong Biomarker [7]
Atherosclerosis DISMN9J3 moderate Altered Expression [8]
Breast cancer DIS7DPX1 moderate Genetic Variation [9]
Breast carcinoma DIS2UE88 moderate Genetic Variation [9]
Melanoma DIS1RRCY moderate Genetic Variation [9]
Arteriosclerosis DISK5QGC Limited Biomarker [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Actin-related protein T1 (ACTRT1). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Actin-related protein T1 (ACTRT1). [12]
------------------------------------------------------------------------------------

References

1 Antiamyloidogenic Activity of A42-Binding Peptoid in Modulating Amyloid Oligomerization.Small. 2017 Jan;13(1). doi: 10.1002/smll.201602857. Epub 2016 Oct 7.
2 AIP1-mediated stress signaling in atherosclerosis and arteriosclerosis.Curr Atheroscler Rep. 2015 May;17(5):503. doi: 10.1007/s11883-015-0503-z.
3 Outcome and Genetic Factors in IgG4-Associated Autoimmune Pancreatitis and Cholangitis: A Single Center Experience.Gastroenterol Res Pract. 2017;2017:6126707. doi: 10.1155/2017/6126707. Epub 2017 Mar 2.
4 Suppression of inflammation and tissue damage by a hookworm recombinant protein in experimental colitis.Clin Transl Immunology. 2017 Oct 6;6(10):e157. doi: 10.1038/cti.2017.42. eCollection 2017 Oct.
5 Low expression level of ASK1-interacting protein-1 correlated with tumor angiogenesis and poor survival in patients with esophageal squamous cell cancer.Onco Targets Ther. 2018 Nov 1;11:7699-7707. doi: 10.2147/OTT.S178131. eCollection 2018.
6 A common genetic variant (97906C>A) of DAB2IP/AIP1 is associated with an increased risk and early onset of lung cancer in Chinese males.PLoS One. 2011;6(10):e26944. doi: 10.1371/journal.pone.0026944. Epub 2011 Oct 26.
7 Ca2+ binding to EF hands 1 and 3 is essential for the interaction of apoptosis-linked gene-2 with Alix/AIP1 in ocular melanoma.Biochemistry. 2004 Sep 7;43(35):11175-86. doi: 10.1021/bi048848d.
8 Endothelial AIP1 Regulates Vascular Remodeling by Suppressing NADPH Oxidase-2.Front Physiol. 2018 Apr 20;9:396. doi: 10.3389/fphys.2018.00396. eCollection 2018.
9 AIP1 Expression in Tumor Niche Suppresses Tumor Progression and Metastasis.Cancer Res. 2015 Sep 1;75(17):3492-504. doi: 10.1158/0008-5472.CAN-15-0088. Epub 2015 Jul 2.
10 Short AIP1 (ASK1-Interacting Protein-1) Isoform Localizes to the Mitochondria and Promotes Vascular Dysfunction.Arterioscler Thromb Vasc Biol. 2020 Jan;40(1):112-127. doi: 10.1161/ATVBAHA.119.312976. Epub 2019 Oct 17.
11 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.