Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ2LZKQ)

DOT Name Sal-like protein 3 (SALL3)
Synonyms Zinc finger protein 796; Zinc finger protein SALL3; hSALL3
Gene Name SALL3
Related Disease
Advanced cancer ( )
Cervical cancer ( )
Cervical carcinoma ( )
Chordoma ( )
Gastrointestinal stromal tumour ( )
Hepatocellular carcinoma ( )
Human papillomavirus infection ( )
Malignant thymoma ( )
Neoplasm ( )
Alcohol dependence ( )
Burkitt lymphoma ( )
Congenital contractural arachnodactyly ( )
UniProt ID
SALL3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7Y3L
Pfam ID
PF00096 ; PF12874
Sequence
MSRRKQAKPQHLKSDEELLPPDGAPEHAAPGEGAEDADSGPESRSGGEETSVCEKCCAEF
FKWADFLEHQRSCTKLPPVLIVHEDAPAPPPEDFPEPSPASSPSERAESEAAEEAGAEGA
EGEARPVEKEAEPMDAEPAGDTRAPRPPPAAPAPPTPAYGAPSTNVTLEALLSTKVAVAQ
FSQGARAAGGSGAGGGVAAAAVPLILEQLMALQQQQIHQLQLIEQIRSQVALMQRPPPRP
SLSPAAAPSAPGPAPSQLPGLAALPLSAGAPAAAIAGSGPAAPAAFEGAQPLSRPESGAS
TPGGPAEPSAPAAPSAAPAPAAPAPAPAPQSAASSQPQSASTPPALAPGSLLGAAPGLPS
PLLPQTSASGVIFPNPLVSIAATANALDPLSALMKHRKGKPPNVSVFEPKASAEDPFFKH
KCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLKVHFQRHKEKYPHIQMN
PYPVPEYLDNVPTCSGIPYGMSLPPEKPVTTWLDSKPVLPTVPTSVGLQLPPTVPGAHGY
ADSPSATPASRSPQRPSPASSECASLSPGLNHVESGVSATAESPQSLLGGPPLTKAEPVS
LPCTNARAGDAPVGAQASAAPTSVDGAPTSLGSPGLPAVSEQFKAQFPFGGLLDSMQTSE
TSKLQQLVENIDKKMTDPNQCVICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKG
NLKTHFGVHRAKPPLRVQHSCPICQKKFTNAVVLQQHIRMHMGGQIPNTPLPEGFQDAMD
SELAYDDKNAETLSSYDDDMDENSMEDDAELKDAATDPAKPLLSYAGSCPPSPPSVISSI
AALENQMKMIDSVMSCQQLTGLKSVENGSGESDRLSNDSSSAVGDLESRSAGSPALSESS
SSQALSPAPSNGESFRSKSPGLGAPEEPQEIPLKTERPDSPAAAPGSGGAPGRAGIKEEA
PFSLLFLSRERGKCPSTVCGVCGKPFACKSALEIHYRSHTKERPFVCALCRRGCSTMGNL
KQHLLTHRLKELPSQLFDPNFALGPSQSTPSLISSAAPTMIKMEVNGHGKAMALGEGPPL
PAGVQVPAGPQTVMGPGLAPMLAPPPRRTPKQHNCQSCGKTFSSASALQIHERTHTGEKP
FGCTICGRAFTTKGNLKVHMGTHMWNNAPARRGRRLSVENPMALLGGDALKFSEMFQKDL
AARAMNVDPSFWNQYAAAITNGLAMKNNEISVIQNGGIPQLPVSLGGSALPPLGSMASGM
DKARTGSSPPIVSLDKASSETAASRPFTRFIEDNKEIGIN
Function Probable transcription factor.
Tissue Specificity Widely expressed in adult with highest levels in heart. Expressed in fetal brain (in neurons of hippocampus, cortex, mediodorsal and ventrolateral thalamic nuclei, putamen, cerebellum and brainstem).

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Genetic Variation [1]
Cervical cancer DISFSHPF Strong Posttranslational Modification [2]
Cervical carcinoma DIST4S00 Strong Posttranslational Modification [2]
Chordoma DISCHJE7 Strong Biomarker [3]
Gastrointestinal stromal tumour DIS6TJYS Strong Biomarker [4]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [5]
Human papillomavirus infection DISX61LX Strong Posttranslational Modification [2]
Malignant thymoma DIS59MOU Strong Posttranslational Modification [1]
Neoplasm DISZKGEW Strong Posttranslational Modification [2]
Alcohol dependence DIS4ZSCO moderate Biomarker [6]
Burkitt lymphoma DIS9D5XU moderate Biomarker [7]
Congenital contractural arachnodactyly DISOM1K7 Limited Biomarker [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Sal-like protein 3 (SALL3). [9]
Fulvestrant DM0YZC6 Approved Fulvestrant affects the methylation of Sal-like protein 3 (SALL3). [13]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Sal-like protein 3 (SALL3). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Sal-like protein 3 (SALL3). [13]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Sal-like protein 3 (SALL3). [10]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Sal-like protein 3 (SALL3). [11]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Sal-like protein 3 (SALL3). [12]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Sal-like protein 3 (SALL3). [11]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Sal-like protein 3 (SALL3). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Sal-like protein 3 (SALL3). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Sal-like protein 3 (SALL3). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 DNA methylation of GHSR, GNG4, HOXD9 and SALL3 is a common epigenetic alteration in thymic carcinoma.Int J Oncol. 2020 Jan;56(1):315-326. doi: 10.3892/ijo.2019.4915. Epub 2019 Nov 18.
2 Aberrant Hypermethylation of SALL3 with HPV Involvement Contributes to the Carcinogenesis of Cervical Cancer.PLoS One. 2015 Dec 23;10(12):e0145700. doi: 10.1371/journal.pone.0145700. eCollection 2015.
3 Transcriptome comparison identifies potential biomarkers of spine and skull base chordomas.Virchows Arch. 2018 Mar;472(3):489-497. doi: 10.1007/s00428-017-2224-x. Epub 2017 Aug 27.
4 Hedgehog pathway dysregulation contributes to the pathogenesis of human gastrointestinal stromal tumors via GLI-mediated activation of KIT expression. Oncotarget. 2016 Nov 29;7(48):78226-78241. doi: 10.18632/oncotarget.12909.
5 Aberrant methylation and downregulation of sall3 in human hepatocellular carcinoma.World J Gastroenterol. 2012 Jun 7;18(21):2719-26. doi: 10.3748/wjg.v18.i21.2719.
6 Inferring Alcoholism SNPs and Regulatory Chemical Compounds Based on Ensemble Bayesian Network.Comb Chem High Throughput Screen. 2017;20(2):107-115. doi: 10.2174/1386207319666161220114917.
7 The genetic landscape of mutations in Burkitt lymphoma.Nat Genet. 2012 Dec;44(12):1321-5. doi: 10.1038/ng.2468. Epub 2012 Nov 11.
8 Investigation of miRNA- and lncRNA-mediated competing endogenous RNA network in cholangiocarcinoma.Oncol Lett. 2019 Nov;18(5):5283-5293. doi: 10.3892/ol.2019.10852. Epub 2019 Sep 12.
9 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
10 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
11 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
12 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
13 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.