Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJZWPS6)

DOT Name Transmembrane protein 8B (TMEM8B)
Synonyms Nasopharyngeal carcinoma-associated gene 6 protein; Protein NAG-5; Protein NGX6
Gene Name TMEM8B
Related Disease
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Carcinoma of esophagus ( )
Colon cancer ( )
Colon carcinoma ( )
Gastric cancer ( )
Gonorrhea ( )
Metastatic malignant neoplasm ( )
Nasopharyngeal carcinoma ( )
Neoplasm ( )
Stomach cancer ( )
Colorectal neoplasm ( )
Lung cancer ( )
Lung carcinoma ( )
Streptococcus infection ( )
UniProt ID
TMM8B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12036
Sequence
MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPS
VALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAV
TCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMR
TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC
LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL
GSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA
WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS
VGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS
Function May function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Posttranslational Modification [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Carcinoma DISH9F1N Strong Altered Expression [3]
Carcinoma of esophagus DISS6G4D Strong Altered Expression [4]
Colon cancer DISVC52G Strong Biomarker [5]
Colon carcinoma DISJYKUO Strong Biomarker [5]
Gastric cancer DISXGOUK Strong Altered Expression [6]
Gonorrhea DISQ5AO6 Strong Altered Expression [6]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [7]
Nasopharyngeal carcinoma DISAOTQ0 Strong Biomarker [7]
Neoplasm DISZKGEW Strong Biomarker [3]
Stomach cancer DISKIJSX Strong Altered Expression [6]
Colorectal neoplasm DISR1UCN Limited Altered Expression [8]
Lung cancer DISCM4YA Limited Altered Expression [7]
Lung carcinoma DISTR26C Limited Altered Expression [7]
Streptococcus infection DIS04U9T Limited Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Transmembrane protein 8B (TMEM8B). [9]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Transmembrane protein 8B (TMEM8B). [10]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Transmembrane protein 8B (TMEM8B). [11]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Transmembrane protein 8B (TMEM8B). [12]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Transmembrane protein 8B (TMEM8B). [13]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Transmembrane protein 8B (TMEM8B). [14]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Transmembrane protein 8B (TMEM8B). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Transmembrane protein 8B (TMEM8B). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Transmembrane protein 8B (TMEM8B). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 NGX6 gene mediated by promoter methylation as a potential molecular marker in colorectal cancer.BMC Cancer. 2010 Apr 27;10:160. doi: 10.1186/1471-2407-10-160.
2 NGX6 expression improves the sensitivity of tamoxifen-resistant MCF-7 cells through modulation of the Smad signaling pathway.Int J Oncol. 2013 Jun;42(6):2060-8. doi: 10.3892/ijo.2013.1886. Epub 2013 Apr 8.
3 Tumor suppressor NGX6 inhibits the growth and metastasis of multiple cancers.Tumour Biol. 2016 May;37(5):5751-60. doi: 10.1007/s13277-016-4966-5. Epub 2016 Feb 15.
4 Effects of NGX6 expression on proliferation and invasion of nasopharyngeal carcinoma cells and survival of patients.Eur Rev Med Pharmacol Sci. 2017 Dec;21(23):5378-5385. doi: 10.26355/eurrev_201712_13923.
5 Tumor suppressor gene NGX6 induces changes in protein expression profiles in colon cancer HT-29 cells.Acta Biochim Biophys Sin (Shanghai). 2012 Jul;44(7):584-90. doi: 10.1093/abbs/gms042. Epub 2012 May 30.
6 DNA promoter and histone H3 methylation downregulate NGX6 in gastric cancer cells.Med Oncol. 2014 Jan;31(1):817. doi: 10.1007/s12032-013-0817-z. Epub 2013 Dec 14.
7 Expression and purification of a rapidly degraded protein, TMEM8B-a, in mammalian cell line.Protein Expr Purif. 2018 Nov;151:38-45. doi: 10.1016/j.pep.2018.06.002. Epub 2018 Jun 8.
8 Expression of tumor related genes NGX6, NAG-7, BRD7 in gastric and colorectal cancer.World J Gastroenterol. 2003 Aug;9(8):1729-33. doi: 10.3748/wjg.v9.i8.1729.
9 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
10 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
11 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
12 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
13 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
14 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
15 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
16 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.