Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM6GDJJ)

• DOT Name: Protein phosphatase 1J (PPM1J)
• Synonyms: EC 3.1.3.16; Protein phosphatase 2C isoform zeta; PP2C-zeta
• Gene Name: PPM1J
• UniProt ID: PPM1J_HUMAN
• EC Number: 3.1.3.16
• Pfam ID: PF00481
• Sequence:
  MLNRVRSAVAHLVSSGGAPPPRPKSPDLPNAASAPPAAAPEAPRSPPAKAGSGSATPAKA
  VEARASFSRPTFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE
  DQACCEVVYVEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIREQ
  LKDLVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAVENAF
  QLMDEQMARERRGHQVEGGCCALVVIYLLGKVYVANAGDSRAIIVRNGEIIPMSREFTPE
  TERQRLQLLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLR
  FPLVCGEGKKARVMATIGVTRGLGDHSLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPD
  DVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRL
  PNNKLGSGDDISVFVIPLGGPGSYS

Molecular Interaction Atlas (MIA) of This DOT

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein phosphatase 1J (PPM1J).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein phosphatase 1J (PPM1J).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein phosphatase 1J (PPM1J).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein phosphatase 1J (PPM1J).	[4]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Protein phosphatase 1J (PPM1J).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein phosphatase 1J (PPM1J).	[6]
Selenium	DM25CGV	Approved	Selenium increases the expression of Protein phosphatase 1J (PPM1J).	[7]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Protein phosphatase 1J (PPM1J).	[8]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Protein phosphatase 1J (PPM1J).	[9]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein phosphatase 1J (PPM1J).	[8]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Protein phosphatase 1J (PPM1J).	[4]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Protein phosphatase 1J (PPM1J).	[7]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 increases the expression of Protein phosphatase 1J (PPM1J).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein phosphatase 1J (PPM1J).	[11]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Protein phosphatase 1J (PPM1J).	[10]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Protein phosphatase 1J (PPM1J).	[12]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Protein phosphatase 1J (PPM1J).	[13]

References

• [1] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [8] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [9] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [10] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [11] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [12] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [13] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.